BLASTX nr result
ID: Coptis25_contig00027211
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00027211 (352 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_001238159.1| receptor-like serine/threonine kinase [Glyci... 56 3e-06 >ref|NP_001238159.1| receptor-like serine/threonine kinase [Glycine max] gi|212717161|gb|ACJ37422.1| receptor-like serine/threonine kinase [Glycine max] Length = 1321 Score = 56.2 bits (134), Expect = 3e-06 Identities = 23/43 (53%), Positives = 35/43 (81%) Frame = +2 Query: 29 MKFMQGLDARFQSIRSQILLMDPFPRMSKIYSLIQQEEKQQEI 157 M+F+ GLD F +IR QIL +DPFP ++K+++L+ QEEKQ+E+ Sbjct: 126 MQFLMGLDESFSTIRGQILSIDPFPSITKVFALVVQEEKQKEV 168