BLASTX nr result
ID: Coptis25_contig00027083
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00027083 (277 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002442940.1| hypothetical protein SORBIDRAFT_08g005120 [S... 60 2e-07 ref|XP_003633403.1| PREDICTED: mature T-cell proliferation 1 nei... 60 2e-07 tpg|DAA55474.1| TPA: hypothetical protein ZEAMMB73_558086 [Zea m... 59 4e-07 gb|ACG25663.1| hypothetical protein [Zea mays] 59 4e-07 ref|XP_002529007.1| conserved hypothetical protein [Ricinus comm... 59 5e-07 >ref|XP_002442940.1| hypothetical protein SORBIDRAFT_08g005120 [Sorghum bicolor] gi|241943633|gb|EES16778.1| hypothetical protein SORBIDRAFT_08g005120 [Sorghum bicolor] Length = 63 Score = 60.1 bits (144), Expect = 2e-07 Identities = 24/34 (70%), Positives = 31/34 (91%) Frame = -3 Query: 272 FNSQRCQKVIELLQSCCEECKYSSTHCASVSGLL 171 F+S++C +VI+LLQSCCE+C+Y STHC SVSGLL Sbjct: 25 FDSRKCVRVIQLLQSCCEQCEYKSTHCGSVSGLL 58 >ref|XP_003633403.1| PREDICTED: mature T-cell proliferation 1 neighbor protein-like isoform 1 [Vitis vinifera] gi|297739547|emb|CBI29729.3| unnamed protein product [Vitis vinifera] Length = 63 Score = 60.1 bits (144), Expect = 2e-07 Identities = 25/35 (71%), Positives = 31/35 (88%) Frame = -3 Query: 275 NFNSQRCQKVIELLQSCCEECKYSSTHCASVSGLL 171 NF Q+C++VIELLQSCCE+C+Y+STHC SVS LL Sbjct: 24 NFLPQKCRRVIELLQSCCEKCEYNSTHCGSVSDLL 58 >tpg|DAA55474.1| TPA: hypothetical protein ZEAMMB73_558086 [Zea mays] Length = 63 Score = 58.9 bits (141), Expect = 4e-07 Identities = 23/34 (67%), Positives = 31/34 (91%) Frame = -3 Query: 272 FNSQRCQKVIELLQSCCEECKYSSTHCASVSGLL 171 F+S++C +VI+LLQSCCE+C+Y STHC S+SGLL Sbjct: 25 FDSRKCVRVIQLLQSCCEQCEYKSTHCGSLSGLL 58 >gb|ACG25663.1| hypothetical protein [Zea mays] Length = 63 Score = 58.9 bits (141), Expect = 4e-07 Identities = 23/34 (67%), Positives = 31/34 (91%) Frame = -3 Query: 272 FNSQRCQKVIELLQSCCEECKYSSTHCASVSGLL 171 F+S++C +VI+LLQSCCE+C+Y STHC S+SGLL Sbjct: 25 FDSRKCVRVIQLLQSCCEQCEYKSTHCGSLSGLL 58 >ref|XP_002529007.1| conserved hypothetical protein [Ricinus communis] gi|223531547|gb|EEF33377.1| conserved hypothetical protein [Ricinus communis] Length = 64 Score = 58.5 bits (140), Expect = 5e-07 Identities = 26/35 (74%), Positives = 28/35 (80%) Frame = -3 Query: 275 NFNSQRCQKVIELLQSCCEECKYSSTHCASVSGLL 171 NF QRC KVIE LQSCCE+C+Y STHC SVS LL Sbjct: 24 NFLPQRCLKVIENLQSCCEKCEYKSTHCGSVSSLL 58