BLASTX nr result
ID: Coptis25_contig00027024
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00027024 (300 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002458168.1| hypothetical protein SORBIDRAFT_03g028130 [S... 38 5e-06 >ref|XP_002458168.1| hypothetical protein SORBIDRAFT_03g028130 [Sorghum bicolor] gi|241930143|gb|EES03288.1| hypothetical protein SORBIDRAFT_03g028130 [Sorghum bicolor] Length = 694 Score = 37.7 bits (86), Expect(2) = 5e-06 Identities = 15/46 (32%), Positives = 28/46 (60%) Frame = -1 Query: 141 LKEIHGFAIKQKGIIDVDSIDDDKLRASIVAGYAFHRCMSYACRLF 4 L+E+H F ++ ++ + +D D+L+ S+ AGY + YA R+F Sbjct: 208 LRELHAFVLRNAEVVGLGPVDLDRLQESLAAGYMCSSFVQYAGRVF 253 Score = 37.4 bits (85), Expect(2) = 5e-06 Identities = 20/42 (47%), Positives = 29/42 (69%) Frame = -2 Query: 299 IMSGCVRNGDGVLAFETLRRMLVSGSCLNPDSATFITLLSVI 174 +++GCVR G+G LA E L +M+ G + P+ ATF T+L VI Sbjct: 159 VIAGCVRAGNGELAIELLGKMVSIGGVV-PNVATFNTVLHVI 199