BLASTX nr result
ID: Coptis25_contig00027017
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00027017 (216 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003576726.1| PREDICTED: beta-glucosidase 32-like [Brachyp... 57 2e-06 ref|XP_003530290.1| PREDICTED: beta-glucosidase 11-like [Glycine... 56 3e-06 ref|XP_003547863.1| PREDICTED: beta-glucosidase 11-like [Glycine... 56 3e-06 sp|Q0J0G2.2|BGL32_ORYSJ RecName: Full=Beta-glucosidase 32; Short... 55 4e-06 gb|EEC84872.1| hypothetical protein OsI_32015 [Oryza sativa Indi... 55 4e-06 >ref|XP_003576726.1| PREDICTED: beta-glucosidase 32-like [Brachypodium distachyon] Length = 505 Score = 56.6 bits (135), Expect = 2e-06 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = +2 Query: 122 LGRLDFPPGFVFGAGTSAYQVEGASAEDGRK 214 L R DFP GF+FGAGTSAYQVEGA+AEDGRK Sbjct: 24 LTRHDFPDGFIFGAGTSAYQVEGAAAEDGRK 54 >ref|XP_003530290.1| PREDICTED: beta-glucosidase 11-like [Glycine max] Length = 517 Score = 55.8 bits (133), Expect = 3e-06 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = +2 Query: 122 LGRLDFPPGFVFGAGTSAYQVEGASAEDGRK 214 L R DFPPGFVFGA TSAYQVEGA+ EDGRK Sbjct: 25 LSRDDFPPGFVFGASTSAYQVEGAANEDGRK 55 >ref|XP_003547863.1| PREDICTED: beta-glucosidase 11-like [Glycine max] Length = 517 Score = 55.8 bits (133), Expect = 3e-06 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = +2 Query: 122 LGRLDFPPGFVFGAGTSAYQVEGASAEDGRK 214 L R DFPPGFVFGA TSAYQVEGA+ EDGRK Sbjct: 25 LSRDDFPPGFVFGASTSAYQVEGAANEDGRK 55 >sp|Q0J0G2.2|BGL32_ORYSJ RecName: Full=Beta-glucosidase 32; Short=Os9bglu32; Flags: Precursor Length = 508 Score = 55.5 bits (132), Expect = 4e-06 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = +2 Query: 122 LGRLDFPPGFVFGAGTSAYQVEGASAEDGRK 214 L R DFP GFVFGAGTSA+QVEGA+AEDGRK Sbjct: 31 LTRHDFPEGFVFGAGTSAFQVEGAAAEDGRK 61 >gb|EEC84872.1| hypothetical protein OsI_32015 [Oryza sativa Indica Group] Length = 665 Score = 55.5 bits (132), Expect = 4e-06 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = +2 Query: 122 LGRLDFPPGFVFGAGTSAYQVEGASAEDGRK 214 L R DFP GFVFGAGTSA+QVEGA+AEDGRK Sbjct: 31 LTRHDFPEGFVFGAGTSAFQVEGAAAEDGRK 61