BLASTX nr result
ID: Coptis25_contig00026925
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00026925 (216 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002516287.1| 12-oxophytodienoate reductase opr, putative ... 83 2e-14 ref|NP_001233873.1| 12-oxophytodienoate reductase 3 [Solanum lyc... 82 4e-14 pdb|3HGO|A Chain A, Crystal Structure Of The F74yH244Y OPR3 DOUB... 82 4e-14 pdb|2HS8|A Chain A, Crystal Structure Of The Y364f Mutant Of 12-... 82 4e-14 pdb|2HS6|A Chain A, Crystal Structure Of The E291k Mutant Of 12-... 82 4e-14 >ref|XP_002516287.1| 12-oxophytodienoate reductase opr, putative [Ricinus communis] gi|223544773|gb|EEF46289.1| 12-oxophytodienoate reductase opr, putative [Ricinus communis] Length = 391 Score = 83.2 bits (204), Expect = 2e-14 Identities = 38/45 (84%), Positives = 40/45 (88%) Frame = +1 Query: 79 TLFSPYKMSRFNLSHRVVLAPMTRCRALNGIPGAGMVEYYKQRAT 213 TLFSPYKM RFNLSHRVVLAPMTRCRALNGIP A + EYY QR+T Sbjct: 5 TLFSPYKMGRFNLSHRVVLAPMTRCRALNGIPNAALAEYYTQRST 49 >ref|NP_001233873.1| 12-oxophytodienoate reductase 3 [Solanum lycopersicum] gi|62900706|sp|Q9FEW9.1|OPR3_SOLLC RecName: Full=12-oxophytodienoate reductase 3; AltName: Full=12-oxophytodienoate-10,11-reductase 3; Short=OPDA-reductase 3; AltName: Full=LeOPR3 gi|12056507|emb|CAC21424.1| 12-oxophytodienoate reductase 3 [Solanum lycopersicum] Length = 396 Score = 82.0 bits (201), Expect = 4e-14 Identities = 39/54 (72%), Positives = 45/54 (83%) Frame = +1 Query: 52 AAAAEKKNITLFSPYKMSRFNLSHRVVLAPMTRCRALNGIPGAGMVEYYKQRAT 213 A++A+ N LFSPYKM +FNLSHRVVLAPMTRCRALN IP A + EYY+QRAT Sbjct: 2 ASSAQDGNNPLFSPYKMGKFNLSHRVVLAPMTRCRALNNIPQAALGEYYEQRAT 55 >pdb|3HGO|A Chain A, Crystal Structure Of The F74yH244Y OPR3 DOUBLE MUTANT FROM Tomato gi|256599754|pdb|3HGO|B Chain B, Crystal Structure Of The F74yH244Y OPR3 DOUBLE MUTANT FROM Tomato Length = 402 Score = 82.0 bits (201), Expect = 4e-14 Identities = 39/54 (72%), Positives = 45/54 (83%) Frame = +1 Query: 52 AAAAEKKNITLFSPYKMSRFNLSHRVVLAPMTRCRALNGIPGAGMVEYYKQRAT 213 A++A+ N LFSPYKM +FNLSHRVVLAPMTRCRALN IP A + EYY+QRAT Sbjct: 8 ASSAQDGNNPLFSPYKMGKFNLSHRVVLAPMTRCRALNNIPQAALGEYYEQRAT 61 >pdb|2HS8|A Chain A, Crystal Structure Of The Y364f Mutant Of 12- Oxophytodienoate Reductase 3 From Tomato gi|116667817|pdb|2HS8|B Chain B, Crystal Structure Of The Y364f Mutant Of 12- Oxophytodienoate Reductase 3 From Tomato Length = 402 Score = 82.0 bits (201), Expect = 4e-14 Identities = 39/54 (72%), Positives = 45/54 (83%) Frame = +1 Query: 52 AAAAEKKNITLFSPYKMSRFNLSHRVVLAPMTRCRALNGIPGAGMVEYYKQRAT 213 A++A+ N LFSPYKM +FNLSHRVVLAPMTRCRALN IP A + EYY+QRAT Sbjct: 8 ASSAQDGNNPLFSPYKMGKFNLSHRVVLAPMTRCRALNNIPQAALGEYYEQRAT 61 >pdb|2HS6|A Chain A, Crystal Structure Of The E291k Mutant Of 12- Oxophytodienoate Reductase 3 (Opr3) From Tomato gi|116667815|pdb|2HS6|B Chain B, Crystal Structure Of The E291k Mutant Of 12- Oxophytodienoate Reductase 3 (Opr3) From Tomato gi|116667818|pdb|2HSA|B Chain B, Crystal Structure Of 12-Oxophytodienoate Reductase 3 (Opr3) From Tomato gi|116667819|pdb|2HSA|A Chain A, Crystal Structure Of 12-Oxophytodienoate Reductase 3 (Opr3) From Tomato gi|256599757|pdb|3HGS|A Chain A, Crystal Structure Of Tomato Opr3 In Complex With Phb gi|256599758|pdb|3HGS|B Chain B, Crystal Structure Of Tomato Opr3 In Complex With Phb Length = 402 Score = 82.0 bits (201), Expect = 4e-14 Identities = 39/54 (72%), Positives = 45/54 (83%) Frame = +1 Query: 52 AAAAEKKNITLFSPYKMSRFNLSHRVVLAPMTRCRALNGIPGAGMVEYYKQRAT 213 A++A+ N LFSPYKM +FNLSHRVVLAPMTRCRALN IP A + EYY+QRAT Sbjct: 8 ASSAQDGNNPLFSPYKMGKFNLSHRVVLAPMTRCRALNNIPQAALGEYYEQRAT 61