BLASTX nr result
ID: Coptis25_contig00026891
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00026891 (463 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002277486.1| PREDICTED: uncharacterized protein LOC100250... 71 1e-10 ref|XP_002525659.1| conserved hypothetical protein [Ricinus comm... 55 6e-06 >ref|XP_002277486.1| PREDICTED: uncharacterized protein LOC100250230 [Vitis vinifera] gi|297745882|emb|CBI15938.3| unnamed protein product [Vitis vinifera] Length = 77 Score = 70.9 bits (172), Expect = 1e-10 Identities = 40/79 (50%), Positives = 51/79 (64%), Gaps = 3/79 (3%) Frame = +2 Query: 17 MRVGLRFWWSLLFALGVLLCSAASRNTILVPGNEKMVVVGGGTGRSLK-LQTDDYDDPSA 193 M G R WW + FA L+C+A RNT++ P +E+ G GR LK + TDDY DPSA Sbjct: 1 MGFGNRLWWCVFFA-SFLICTA--RNTLIFPVDEE---AAGAVGRRLKAVSTDDYSDPSA 54 Query: 194 NKGHDPKNK--GGGDSGRN 244 NKGHDP+N+ GGG GR+ Sbjct: 55 NKGHDPRNRIGGGGWKGRD 73 >ref|XP_002525659.1| conserved hypothetical protein [Ricinus communis] gi|223535095|gb|EEF36777.1| conserved hypothetical protein [Ricinus communis] Length = 91 Score = 55.1 bits (131), Expect = 6e-06 Identities = 32/75 (42%), Positives = 45/75 (60%) Frame = +2 Query: 14 DMRVGLRFWWSLLFALGVLLCSAASRNTILVPGNEKMVVVGGGTGRSLKLQTDDYDDPSA 193 D VGL F L+FAL +++RN I + N + TGRSLK +DY +PSA Sbjct: 2 DKGVGLCFCLLLVFAL-----LSSARNPIPISENG---IALANTGRSLKAMLNDYSEPSA 53 Query: 194 NKGHDPKNKGGGDSG 238 N+GHDP++K G ++G Sbjct: 54 NQGHDPRSKDGNNNG 68