BLASTX nr result
ID: Coptis25_contig00026793
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00026793 (290 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI36841.3| unnamed protein product [Vitis vinifera] 69 3e-10 ref|XP_002265012.1| PREDICTED: ABC transporter C family member 4... 69 3e-10 ref|XP_003591546.1| ABC transporter C family protein [Medicago t... 68 9e-10 ref|XP_002523063.1| multidrug resistance-associated protein 2, 6... 67 2e-09 ref|XP_002321011.1| multidrug resistance protein ABC transporter... 64 2e-08 >emb|CBI36841.3| unnamed protein product [Vitis vinifera] Length = 1079 Score = 69.3 bits (168), Expect = 3e-10 Identities = 33/42 (78%), Positives = 37/42 (88%) Frame = +3 Query: 3 CDRVLVIDSGRAIEFDKPSSLLERHSLFAALVREFANSSLGL 128 CDRVLVID+GRA EFDKPS LLERHSLF ALV+E+AN S G+ Sbjct: 1038 CDRVLVIDAGRAKEFDKPSRLLERHSLFGALVQEYANRSAGM 1079 >ref|XP_002265012.1| PREDICTED: ABC transporter C family member 4-like [Vitis vinifera] Length = 1509 Score = 69.3 bits (168), Expect = 3e-10 Identities = 33/42 (78%), Positives = 37/42 (88%) Frame = +3 Query: 3 CDRVLVIDSGRAIEFDKPSSLLERHSLFAALVREFANSSLGL 128 CDRVLVID+GRA EFDKPS LLERHSLF ALV+E+AN S G+ Sbjct: 1468 CDRVLVIDAGRAKEFDKPSRLLERHSLFGALVQEYANRSAGM 1509 >ref|XP_003591546.1| ABC transporter C family protein [Medicago truncatula] gi|355480594|gb|AES61797.1| ABC transporter C family protein [Medicago truncatula] Length = 1515 Score = 67.8 bits (164), Expect = 9e-10 Identities = 32/42 (76%), Positives = 38/42 (90%) Frame = +3 Query: 3 CDRVLVIDSGRAIEFDKPSSLLERHSLFAALVREFANSSLGL 128 CDRVLV+D+GRA EFDKPS+LL+R SLFAALV+E+AN S GL Sbjct: 1474 CDRVLVVDAGRAKEFDKPSNLLQRQSLFAALVQEYANRSTGL 1515 >ref|XP_002523063.1| multidrug resistance-associated protein 2, 6 (mrp2, 6), abc-transoprter, putative [Ricinus communis] gi|223537625|gb|EEF39248.1| multidrug resistance-associated protein 2, 6 (mrp2, 6), abc-transoprter, putative [Ricinus communis] Length = 1506 Score = 66.6 bits (161), Expect = 2e-09 Identities = 33/42 (78%), Positives = 37/42 (88%) Frame = +3 Query: 3 CDRVLVIDSGRAIEFDKPSSLLERHSLFAALVREFANSSLGL 128 CDRVLVID+G+A EFDKPS LLER SLFAALV+E+AN S GL Sbjct: 1465 CDRVLVIDAGKAKEFDKPSRLLERPSLFAALVQEYANRSAGL 1506 >ref|XP_002321011.1| multidrug resistance protein ABC transporter family [Populus trichocarpa] gi|222861784|gb|EEE99326.1| multidrug resistance protein ABC transporter family [Populus trichocarpa] Length = 1507 Score = 63.5 bits (153), Expect = 2e-08 Identities = 32/42 (76%), Positives = 35/42 (83%) Frame = +3 Query: 3 CDRVLVIDSGRAIEFDKPSSLLERHSLFAALVREFANSSLGL 128 CDRVLVID+GR+ EFDKPS LLER SLF ALVRE+AN S L Sbjct: 1466 CDRVLVIDAGRSKEFDKPSRLLERPSLFGALVREYANRSAEL 1507