BLASTX nr result
ID: Coptis25_contig00026526
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00026526 (486 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003523200.1| PREDICTED: aspartic proteinase nepenthesin-1... 55 5e-06 >ref|XP_003523200.1| PREDICTED: aspartic proteinase nepenthesin-1-like [Glycine max] Length = 453 Score = 55.5 bits (132), Expect = 5e-06 Identities = 31/59 (52%), Positives = 38/59 (64%), Gaps = 3/59 (5%) Frame = +1 Query: 250 FVSPTCSLR---VVDNHRSPKKGFWVDLRHVDSVGNYTKLQLLQRGIMRSKHRLARLNS 417 FV+PT S ++ +H P KGF V LRHVDS N TKL+ +Q GI R K RL RLN+ Sbjct: 25 FVAPTSSTSRKTILKHHPYPTKGFRVMLRHVDSGKNLTKLERVQHGIKRGKSRLQRLNA 83