BLASTX nr result
ID: Coptis25_contig00026477
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00026477 (505 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AEH04658.1| UDP-glucuronate decarboxylase [Camellia oleifera] 72 5e-11 gb|AAT40108.1| putative UDP-glucuronate decarboxylase 2 [Nicotia... 70 1e-10 ref|NP_180443.1| UDP-XYL synthase 6 [Arabidopsis thaliana] gi|42... 70 2e-10 gb|AAB68605.1| thymidine diphospho-glucose 4-6-dehydratase homol... 69 3e-10 ref|XP_001775323.1| predicted protein [Physcomitrella patens sub... 68 7e-10 >gb|AEH04658.1| UDP-glucuronate decarboxylase [Camellia oleifera] Length = 340 Score = 72.0 bits (175), Expect = 5e-11 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +2 Query: 410 RILLTSTSEVYGDPLVHPQTEDYWGNVNPIGV 505 RILLTSTSEVYGDPLVHPQTEDYWGNVNPIGV Sbjct: 135 RILLTSTSEVYGDPLVHPQTEDYWGNVNPIGV 166 >gb|AAT40108.1| putative UDP-glucuronate decarboxylase 2 [Nicotiana tabacum] Length = 346 Score = 70.5 bits (171), Expect = 1e-10 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = +2 Query: 410 RILLTSTSEVYGDPLVHPQTEDYWGNVNPIGV 505 RILLTSTSEVYGDPLVHPQTE+YWGNVNPIGV Sbjct: 141 RILLTSTSEVYGDPLVHPQTEEYWGNVNPIGV 172 >ref|NP_180443.1| UDP-XYL synthase 6 [Arabidopsis thaliana] gi|42570963|ref|NP_973555.1| UDP-XYL synthase 6 [Arabidopsis thaliana] gi|145329973|ref|NP_001077972.1| UDP-XYL synthase 6 [Arabidopsis thaliana] gi|3927825|gb|AAC79582.1| putative nucleotide-sugar dehydratase [Arabidopsis thaliana] gi|20466474|gb|AAM20554.1| putative nucleotide-sugar dehydratase [Arabidopsis thaliana] gi|22136442|gb|AAM91299.1| putative nucleotide-sugar dehydratase [Arabidopsis thaliana] gi|330253073|gb|AEC08167.1| UDP-XYL synthase 6 [Arabidopsis thaliana] gi|330253074|gb|AEC08168.1| UDP-XYL synthase 6 [Arabidopsis thaliana] gi|330253075|gb|AEC08169.1| UDP-XYL synthase 6 [Arabidopsis thaliana] Length = 343 Score = 69.7 bits (169), Expect = 2e-10 Identities = 31/32 (96%), Positives = 31/32 (96%) Frame = +2 Query: 410 RILLTSTSEVYGDPLVHPQTEDYWGNVNPIGV 505 RILLTSTSEVYGDPLVHPQTE YWGNVNPIGV Sbjct: 139 RILLTSTSEVYGDPLVHPQTESYWGNVNPIGV 170 >gb|AAB68605.1| thymidine diphospho-glucose 4-6-dehydratase homolog [Prunus armeniaca] Length = 265 Score = 69.3 bits (168), Expect = 3e-10 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = +2 Query: 410 RILLTSTSEVYGDPLVHPQTEDYWGNVNPIGV 505 RILLTSTSEVYGDPL+HPQTE YWGNVNPIGV Sbjct: 60 RILLTSTSEVYGDPLIHPQTESYWGNVNPIGV 91 >ref|XP_001775323.1| predicted protein [Physcomitrella patens subsp. patens] gi|162673404|gb|EDQ59928.1| predicted protein [Physcomitrella patens subsp. patens] Length = 339 Score = 68.2 bits (165), Expect = 7e-10 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = +2 Query: 410 RILLTSTSEVYGDPLVHPQTEDYWGNVNPIGV 505 RILLTSTSEVYGDPL HPQTE+YWGNVNPIGV Sbjct: 135 RILLTSTSEVYGDPLEHPQTEEYWGNVNPIGV 166