BLASTX nr result
ID: Coptis25_contig00026083
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00026083 (279 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI29251.3| unnamed protein product [Vitis vinifera] 80 1e-13 ref|XP_002511098.1| gcn4-complementing protein, putative [Ricinu... 78 8e-13 ref|XP_004167355.1| PREDICTED: ADP-ribosylation factor GTPase-ac... 77 1e-12 ref|XP_004152319.1| PREDICTED: ADP-ribosylation factor GTPase-ac... 77 1e-12 gb|AEL98882.1| ADP-ribosylation factor GTPase-activating protein... 74 1e-11 >emb|CBI29251.3| unnamed protein product [Vitis vinifera] Length = 832 Score = 80.5 bits (197), Expect = 1e-13 Identities = 45/95 (47%), Positives = 61/95 (64%), Gaps = 3/95 (3%) Frame = +3 Query: 3 KFIHAKYAEKLFVRKPKGQHHSFSVSQQMQNSVRSNDKKAVYRHIVCSGANVNAVNKRM- 179 K+IHAKYAEKLFVRKPK + V+QQ+ ++VR+NDKKAVYR+IV S A+VN V ++ Sbjct: 626 KYIHAKYAEKLFVRKPKDNQYPCLVTQQIWDAVRTNDKKAVYRYIVNSEADVNVVYEQTL 685 Query: 180 --XXXXXXXXXXXXNEPSLDRNSSCLEEDSSEKTS 278 + +LD +S CL DS +K+S Sbjct: 686 CNSSLTLAKVMLLQEQTNLDHSSRCLTGDSFDKSS 720 >ref|XP_002511098.1| gcn4-complementing protein, putative [Ricinus communis] gi|223550213|gb|EEF51700.1| gcn4-complementing protein, putative [Ricinus communis] Length = 818 Score = 77.8 bits (190), Expect = 8e-13 Identities = 40/87 (45%), Positives = 54/87 (62%), Gaps = 3/87 (3%) Frame = +3 Query: 3 KFIHAKYAEKLFVRKPKGQHHSFSVSQQMQNSVRSNDKKAVYRHIVCSGANVNAVNKR-- 176 +FIHAKYAEK+F+ K K H V++Q+ SV +NDKKAVYRHIVCSGA+VNA++ + Sbjct: 627 QFIHAKYAEKIFIHKIKDDQHLLPVAEQVWESVYANDKKAVYRHIVCSGADVNAIHGQAS 686 Query: 177 -MXXXXXXXXXXXXNEPSLDRNSSCLE 254 + +LD N CL+ Sbjct: 687 FSTSSSLTSVIQYKQQENLDLNFDCLQ 713 >ref|XP_004167355.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein AGD3-like, partial [Cucumis sativus] Length = 1194 Score = 77.4 bits (189), Expect = 1e-12 Identities = 39/59 (66%), Positives = 47/59 (79%) Frame = +3 Query: 3 KFIHAKYAEKLFVRKPKGQHHSFSVSQQMQNSVRSNDKKAVYRHIVCSGANVNAVNKRM 179 KFIHAKYAEK FVRKPK + V+QQ+ + VRSNDKKAVYRHI+ S A+VNAV K++ Sbjct: 611 KFIHAKYAEKAFVRKPKEIQYPHLVAQQIWDGVRSNDKKAVYRHIINSEADVNAVYKQV 669 >ref|XP_004152319.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein AGD3-like [Cucumis sativus] Length = 1191 Score = 77.4 bits (189), Expect = 1e-12 Identities = 39/59 (66%), Positives = 47/59 (79%) Frame = +3 Query: 3 KFIHAKYAEKLFVRKPKGQHHSFSVSQQMQNSVRSNDKKAVYRHIVCSGANVNAVNKRM 179 KFIHAKYAEK FVRKPK + V+QQ+ + VRSNDKKAVYRHI+ S A+VNAV K++ Sbjct: 608 KFIHAKYAEKAFVRKPKEIQYPHLVAQQIWDGVRSNDKKAVYRHIINSEADVNAVYKQV 666 >gb|AEL98882.1| ADP-ribosylation factor GTPase-activating protein, partial [Silene latifolia] Length = 725 Score = 73.9 bits (180), Expect = 1e-11 Identities = 38/55 (69%), Positives = 43/55 (78%) Frame = +3 Query: 3 KFIHAKYAEKLFVRKPKGQHHSFSVSQQMQNSVRSNDKKAVYRHIVCSGANVNAV 167 KFIHAKYAEKLFVRKPK H S+SQQ+ VR+NDKKAVYR IV A+VNA+ Sbjct: 623 KFIHAKYAEKLFVRKPKDTQHLRSLSQQIWEGVRTNDKKAVYRCIVNFEADVNAI 677