BLASTX nr result
ID: Coptis25_contig00026038
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00026038 (273 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002514656.1| hypothetical protein RCOM_1469830 [Ricinus c... 56 3e-06 >ref|XP_002514656.1| hypothetical protein RCOM_1469830 [Ricinus communis] gi|223546260|gb|EEF47762.1| hypothetical protein RCOM_1469830 [Ricinus communis] Length = 677 Score = 55.8 bits (133), Expect = 3e-06 Identities = 27/33 (81%), Positives = 30/33 (90%) Frame = -3 Query: 253 EMARLLIKQIVEKTRQGSPVVLNAQRMLFQMDE 155 EM + LIKQIVEKTR+GSPVVLNAQR+LF MDE Sbjct: 642 EMEKQLIKQIVEKTRKGSPVVLNAQRLLFSMDE 674