BLASTX nr result
ID: Coptis25_contig00026014
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00026014 (388 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002283791.1| PREDICTED: pentatricopeptide repeat-containi... 67 1e-09 emb|CAN72397.1| hypothetical protein VITISV_041201 [Vitis vinifera] 67 1e-09 ref|XP_004144134.1| PREDICTED: pentatricopeptide repeat-containi... 59 4e-07 ref|XP_002523384.1| pentatricopeptide repeat-containing protein,... 55 4e-06 >ref|XP_002283791.1| PREDICTED: pentatricopeptide repeat-containing protein At5g56310 [Vitis vinifera] Length = 576 Score = 67.4 bits (163), Expect = 1e-09 Identities = 35/83 (42%), Positives = 48/83 (57%) Frame = +1 Query: 136 LLKASLKTMFCTLSTVLRLSSYFSRRKLHTSADIYFLPLLNQCSNFKHINLAHGYMVPRG 315 LL+ S +F T + SY + L LL QCSN KH++ H +M+ RG Sbjct: 21 LLQTSRAALFSTATAAAASPSY------------HLLSLLKQCSNLKHLHQTHCFMLSRG 68 Query: 316 LDQNNLLLSKFIDTCSVLGFTAY 384 LDQ+N+LLS+FI+ CS LGF+ Y Sbjct: 69 LDQDNILLSRFIEACSSLGFSHY 91 >emb|CAN72397.1| hypothetical protein VITISV_041201 [Vitis vinifera] Length = 576 Score = 67.4 bits (163), Expect = 1e-09 Identities = 35/83 (42%), Positives = 48/83 (57%) Frame = +1 Query: 136 LLKASLKTMFCTLSTVLRLSSYFSRRKLHTSADIYFLPLLNQCSNFKHINLAHGYMVPRG 315 LL+ S +F T + SY + L LL QCSN KH++ H +M+ RG Sbjct: 21 LLQTSRAALFSTATAAAASPSY------------HLLSLLKQCSNLKHLHQTHCFMLSRG 68 Query: 316 LDQNNLLLSKFIDTCSVLGFTAY 384 LDQ+N+LLS+FI+ CS LGF+ Y Sbjct: 69 LDQDNILLSRFIEACSSLGFSHY 91 >ref|XP_004144134.1| PREDICTED: pentatricopeptide repeat-containing protein At5g56310-like [Cucumis sativus] gi|449493602|ref|XP_004159370.1| PREDICTED: pentatricopeptide repeat-containing protein At5g56310-like [Cucumis sativus] Length = 548 Score = 58.9 bits (141), Expect = 4e-07 Identities = 30/75 (40%), Positives = 47/75 (62%) Frame = +1 Query: 160 MFCTLSTVLRLSSYFSRRKLHTSADIYFLPLLNQCSNFKHINLAHGYMVPRGLDQNNLLL 339 M + S + + SS F + + TS+ + F LL+ C + H+ HG+M+ R LDQ+NL L Sbjct: 1 MCWSFSLLSKSSSSFFKPAIFTSS-LQFTSLLSNCRHHLHLYQIHGFMLHRALDQDNLFL 59 Query: 340 SKFIDTCSVLGFTAY 384 S+FID C+ LG ++Y Sbjct: 60 SQFIDACTSLGLSSY 74 >ref|XP_002523384.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223537334|gb|EEF38963.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 538 Score = 55.5 bits (132), Expect = 4e-06 Identities = 25/45 (55%), Positives = 32/45 (71%) Frame = +1 Query: 250 LLNQCSNFKHINLAHGYMVPRGLDQNNLLLSKFIDTCSVLGFTAY 384 LLN CSN KH++ H +M+ R LD +NLLLS FI + S LGF+ Y Sbjct: 17 LLNHCSNLKHLHQTHAFMLCRALDHDNLLLSLFIQSSSSLGFSLY 61