BLASTX nr result
ID: Coptis25_contig00025971
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00025971 (303 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002272525.2| PREDICTED: putative pentatricopeptide repeat... 56 3e-06 emb|CBI34855.3| unnamed protein product [Vitis vinifera] 56 3e-06 >ref|XP_002272525.2| PREDICTED: putative pentatricopeptide repeat-containing protein At5g09950 [Vitis vinifera] Length = 1291 Score = 56.2 bits (134), Expect = 3e-06 Identities = 30/51 (58%), Positives = 35/51 (68%), Gaps = 4/51 (7%) Frame = -3 Query: 184 KSEKKIGSDMFVGSAFNEFYSKCKEMGDDLRV----SKPDVVL*TSMVTEY 44 K +IGSDMFVGSA E YSKC +MG+ L+V +PD VL TSMVT Y Sbjct: 130 KKNDEIGSDMFVGSALVELYSKCGQMGEALKVFEEFQRPDTVLWTSMVTGY 180 >emb|CBI34855.3| unnamed protein product [Vitis vinifera] Length = 956 Score = 56.2 bits (134), Expect = 3e-06 Identities = 30/51 (58%), Positives = 35/51 (68%), Gaps = 4/51 (7%) Frame = -3 Query: 184 KSEKKIGSDMFVGSAFNEFYSKCKEMGDDLRV----SKPDVVL*TSMVTEY 44 K +IGSDMFVGSA E YSKC +MG+ L+V +PD VL TSMVT Y Sbjct: 130 KKNDEIGSDMFVGSALVELYSKCGQMGEALKVFEEFQRPDTVLWTSMVTGY 180