BLASTX nr result
ID: Coptis25_contig00025933
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00025933 (368 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003556806.1| PREDICTED: TPR repeat-containing thioredoxin... 69 3e-10 ref|XP_002524280.1| Small glutamine-rich tetratricopeptide repea... 69 3e-10 ref|XP_002317465.1| predicted protein [Populus trichocarpa] gi|2... 69 4e-10 ref|NP_001130313.1| uncharacterized protein LOC100191407 [Zea ma... 69 5e-10 gb|AFW61905.1| hypothetical protein ZEAMMB73_870729 [Zea mays] g... 68 7e-10 >ref|XP_003556806.1| PREDICTED: TPR repeat-containing thioredoxin TTL1-like [Glycine max] Length = 676 Score = 69.3 bits (168), Expect = 3e-10 Identities = 31/50 (62%), Positives = 42/50 (84%) Frame = -1 Query: 368 SVNFVKVDIEVAQSVANVENVRIVPIFKIYKNGATVKEMIFPSHQVLKYS 219 S+NF+KVDI+ + +VA ENVR+VP FKIYKNG+ VKE+I PSH +L++S Sbjct: 621 SINFLKVDIQTSPAVAAAENVRVVPTFKIYKNGSRVKEIICPSHDMLEHS 670 >ref|XP_002524280.1| Small glutamine-rich tetratricopeptide repeat-containing protein A, putative [Ricinus communis] gi|223536471|gb|EEF38119.1| Small glutamine-rich tetratricopeptide repeat-containing protein A, putative [Ricinus communis] Length = 640 Score = 69.3 bits (168), Expect = 3e-10 Identities = 31/50 (62%), Positives = 42/50 (84%) Frame = -1 Query: 368 SVNFVKVDIEVAQSVANVENVRIVPIFKIYKNGATVKEMIFPSHQVLKYS 219 S+NF+KVDI + +VAN EN+RIVP FKIYKNG+ VKE++ PSH +L++S Sbjct: 585 SINFLKVDIGNSPAVANAENIRIVPTFKIYKNGSRVKEIVCPSHDMLEHS 634 >ref|XP_002317465.1| predicted protein [Populus trichocarpa] gi|222860530|gb|EEE98077.1| predicted protein [Populus trichocarpa] Length = 698 Score = 68.9 bits (167), Expect = 4e-10 Identities = 31/50 (62%), Positives = 41/50 (82%) Frame = -1 Query: 368 SVNFVKVDIEVAQSVANVENVRIVPIFKIYKNGATVKEMIFPSHQVLKYS 219 S+NF+KVD+E ++AN E+VRIVP FKIYKNG VKE++ PSH VL++S Sbjct: 643 SINFLKVDVEEHPAIANAEDVRIVPTFKIYKNGNRVKEIVCPSHDVLEHS 692 >ref|NP_001130313.1| uncharacterized protein LOC100191407 [Zea mays] gi|194688818|gb|ACF78493.1| unknown [Zea mays] gi|413947748|gb|AFW80397.1| hypothetical protein ZEAMMB73_358491 [Zea mays] Length = 675 Score = 68.6 bits (166), Expect = 5e-10 Identities = 33/50 (66%), Positives = 39/50 (78%) Frame = -1 Query: 368 SVNFVKVDIEVAQSVANVENVRIVPIFKIYKNGATVKEMIFPSHQVLKYS 219 SVNF+KVD+ + +VA ENVR VP FKIYKNG VKEMI PS Q+L+YS Sbjct: 620 SVNFLKVDVNESPAVARAENVRTVPTFKIYKNGIRVKEMICPSQQLLEYS 669 >gb|AFW61905.1| hypothetical protein ZEAMMB73_870729 [Zea mays] gi|414875705|tpg|DAA52836.1| TPA: hypothetical protein ZEAMMB73_661523 [Zea mays] Length = 670 Score = 68.2 bits (165), Expect = 7e-10 Identities = 32/50 (64%), Positives = 39/50 (78%) Frame = -1 Query: 368 SVNFVKVDIEVAQSVANVENVRIVPIFKIYKNGATVKEMIFPSHQVLKYS 219 SVNF+KVD+ + +VA ENVR +P FKIYKNG VKEMI PS Q+L+YS Sbjct: 615 SVNFLKVDVNESPAVARAENVRTIPTFKIYKNGIRVKEMICPSQQLLEYS 664