BLASTX nr result
ID: Coptis25_contig00025687
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00025687 (246 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002321027.1| predicted protein [Populus trichocarpa] gi|2... 70 2e-10 ref|XP_002520664.1| conserved hypothetical protein [Ricinus comm... 64 2e-08 ref|XP_002520663.1| conserved hypothetical protein [Ricinus comm... 63 2e-08 ref|XP_002511212.1| conserved hypothetical protein [Ricinus comm... 62 4e-08 emb|CAN68940.1| hypothetical protein VITISV_028995 [Vitis vinifera] 62 6e-08 >ref|XP_002321027.1| predicted protein [Populus trichocarpa] gi|222861800|gb|EEE99342.1| predicted protein [Populus trichocarpa] Length = 400 Score = 69.7 bits (169), Expect = 2e-10 Identities = 37/81 (45%), Positives = 51/81 (62%) Frame = -2 Query: 245 LSGPDLAQVISKDPNILYFS*ENKIKPSIAFLKGVVHSETNVKTVIRRTTKILDQDPQKR 66 +S P LA+ +S DP +L S EN+I PS FLK ++ S+ + + +RTT I +D K Sbjct: 141 MSRPHLARTLSSDPTLLTRSLENQIVPSYNFLKTILRSDEKIVSAFKRTTWIFLEDLSKN 200 Query: 65 LVPNIALLRTHGVPDSIISKL 3 L+PN+ LLR GVP S IS L Sbjct: 201 LIPNLELLRKVGVPQSCISLL 221 >ref|XP_002520664.1| conserved hypothetical protein [Ricinus communis] gi|223540049|gb|EEF41626.1| conserved hypothetical protein [Ricinus communis] Length = 406 Score = 63.5 bits (153), Expect = 2e-08 Identities = 36/80 (45%), Positives = 49/80 (61%) Frame = -2 Query: 242 SGPDLAQVISKDPNILYFS*ENKIKPSIAFLKGVVHSETNVKTVIRRTTKILDQDPQKRL 63 S LA+ +S DP +L S EN+I PS FLK ++ S+ + + ++RTT I +D K L Sbjct: 143 SNSALARALSSDPTLLTRSLENQIIPSYNFLKSILLSDEKIVSALKRTTWIFLEDHSKNL 202 Query: 62 VPNIALLRTHGVPDSIISKL 3 +PNI LLR GV S IS L Sbjct: 203 IPNIELLREAGVLHSCISLL 222 >ref|XP_002520663.1| conserved hypothetical protein [Ricinus communis] gi|223540048|gb|EEF41625.1| conserved hypothetical protein [Ricinus communis] Length = 377 Score = 63.2 bits (152), Expect = 2e-08 Identities = 35/81 (43%), Positives = 49/81 (60%) Frame = -2 Query: 245 LSGPDLAQVISKDPNILYFS*ENKIKPSIAFLKGVVHSETNVKTVIRRTTKILDQDPQKR 66 +S DLA+ +S DP +L S EN+I PS FLK ++ S + + ++RTT I +D K Sbjct: 117 VSSSDLARTLSSDPTLLTRSIENQIVPSYNFLKSILLSNEKIVSALKRTTWIFLEDYSKN 176 Query: 65 LVPNIALLRTHGVPDSIISKL 3 L+PN+ LR GV S IS L Sbjct: 177 LMPNVERLREIGVTHSCISLL 197 >ref|XP_002511212.1| conserved hypothetical protein [Ricinus communis] gi|223550327|gb|EEF51814.1| conserved hypothetical protein [Ricinus communis] Length = 423 Score = 62.4 bits (150), Expect = 4e-08 Identities = 32/72 (44%), Positives = 48/72 (66%) Frame = -2 Query: 233 DLAQVISKDPNILYFS*ENKIKPSIAFLKGVVHSETNVKTVIRRTTKILDQDPQKRLVPN 54 D+AQ++S +P IL S EN I P + L+ VV ++NV VI+ + +IL+ + +K L PN Sbjct: 200 DIAQILSAEPYILERSLENTIMPCVQVLRRVVGDDSNVLKVIKASYRILEVNVKKMLEPN 259 Query: 53 IALLRTHGVPDS 18 + LL HGVP+S Sbjct: 260 MLLLANHGVPES 271 >emb|CAN68940.1| hypothetical protein VITISV_028995 [Vitis vinifera] Length = 379 Score = 61.6 bits (148), Expect = 6e-08 Identities = 35/77 (45%), Positives = 46/77 (59%) Frame = -2 Query: 242 SGPDLAQVISKDPNILYFS*ENKIKPSIAFLKGVVHSETNVKTVIRRTTKILDQDPQKRL 63 SGPD+A ++S +P IL +N + P+ FLK VV NV V+R+T I Q QK + Sbjct: 110 SGPDIAGILSSNPYILKRGLQNNLIPTYTFLKSVVMVNENVVRVLRKTHWITVQSVQKAI 169 Query: 62 VPNIALLRTHGVPDSII 12 PNIA+L GVP S I Sbjct: 170 TPNIAILTEIGVPMSNI 186