BLASTX nr result
ID: Coptis25_contig00025679
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00025679 (273 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI27231.3| unnamed protein product [Vitis vinifera] 60 1e-12 ref|XP_002273828.1| PREDICTED: uncharacterized amino acid permea... 59 2e-12 ref|XP_002890204.1| hypothetical protein ARALYDRAFT_471910 [Arab... 55 6e-12 ref|NP_173155.1| cationic amino acid transporter 8 [Arabidopsis ... 54 8e-12 ref|XP_002300432.1| cationic amino acid transporter [Populus tri... 56 1e-11 >emb|CBI27231.3| unnamed protein product [Vitis vinifera] Length = 702 Score = 60.1 bits (144), Expect(2) = 1e-12 Identities = 29/44 (65%), Positives = 34/44 (77%), Gaps = 2/44 (4%) Frame = +3 Query: 87 FVRFAICTGVMLVYYVFFGLHATYDVAH--QKPLDLETAQGISS 212 F+RF +CT +MLVYYVFFGLHATYDVAH QKP L+ IS+ Sbjct: 657 FIRFGVCTVLMLVYYVFFGLHATYDVAHQQQKPESLKLKFNISA 700 Score = 37.4 bits (85), Expect(2) = 1e-12 Identities = 16/19 (84%), Positives = 16/19 (84%) Frame = +1 Query: 1 KVWGVPLVLWLPSFSIAIN 57 KVWGVPLV WLPS SIA N Sbjct: 627 KVWGVPLVPWLPSLSIATN 645 >ref|XP_002273828.1| PREDICTED: uncharacterized amino acid permease YfnA [Vitis vinifera] Length = 589 Score = 59.3 bits (142), Expect(2) = 2e-12 Identities = 28/41 (68%), Positives = 32/41 (78%), Gaps = 2/41 (4%) Frame = +3 Query: 87 FVRFAICTGVMLVYYVFFGLHATYDVAH--QKPLDLETAQG 203 F+RF +CT +MLVYYVFFGLHATYDVAH QKP L+ G Sbjct: 542 FIRFGVCTVLMLVYYVFFGLHATYDVAHQQQKPESLKFNDG 582 Score = 37.4 bits (85), Expect(2) = 2e-12 Identities = 16/19 (84%), Positives = 16/19 (84%) Frame = +1 Query: 1 KVWGVPLVLWLPSFSIAIN 57 KVWGVPLV WLPS SIA N Sbjct: 512 KVWGVPLVPWLPSLSIATN 530 >ref|XP_002890204.1| hypothetical protein ARALYDRAFT_471910 [Arabidopsis lyrata subsp. lyrata] gi|297336046|gb|EFH66463.1| hypothetical protein ARALYDRAFT_471910 [Arabidopsis lyrata subsp. lyrata] Length = 585 Score = 54.7 bits (130), Expect(2) = 6e-12 Identities = 26/39 (66%), Positives = 31/39 (79%) Frame = +3 Query: 87 FVRFAICTGVMLVYYVFFGLHATYDVAHQKPLDLETAQG 203 F+RF ICT VML+YY+F GLHATYDVAHQ PL+ +G Sbjct: 546 FLRFIICTMVMLLYYLFVGLHATYDVAHQ-PLEESKFEG 583 Score = 40.4 bits (93), Expect(2) = 6e-12 Identities = 17/19 (89%), Positives = 18/19 (94%) Frame = +1 Query: 1 KVWGVPLVLWLPSFSIAIN 57 KVWGVPLV WLPSFSIA+N Sbjct: 516 KVWGVPLVPWLPSFSIAMN 534 >ref|NP_173155.1| cationic amino acid transporter 8 [Arabidopsis thaliana] gi|75313454|sp|Q9SHH0.1|CAAT8_ARATH RecName: Full=Cationic amino acid transporter 8, vacuolar gi|5734765|gb|AAD50030.1|AC007651_25 Very similar to amino acid transporter [Arabidopsis thaliana] gi|18176204|gb|AAL60003.1| putative amino acid transporter protein [Arabidopsis thaliana] gi|21436167|gb|AAM51371.1| putative amino acid transporter protein [Arabidopsis thaliana] gi|332191423|gb|AEE29544.1| cationic amino acid transporter 8 [Arabidopsis thaliana] Length = 590 Score = 54.3 bits (129), Expect(2) = 8e-12 Identities = 26/39 (66%), Positives = 31/39 (79%) Frame = +3 Query: 87 FVRFAICTGVMLVYYVFFGLHATYDVAHQKPLDLETAQG 203 F+RF ICT VML+YY+F GLHATYDVAHQ PL+ +G Sbjct: 551 FLRFIICTMVMLLYYLFVGLHATYDVAHQ-PLEEAKFEG 588 Score = 40.4 bits (93), Expect(2) = 8e-12 Identities = 17/19 (89%), Positives = 18/19 (94%) Frame = +1 Query: 1 KVWGVPLVLWLPSFSIAIN 57 KVWGVPLV WLPSFSIA+N Sbjct: 521 KVWGVPLVPWLPSFSIAMN 539 >ref|XP_002300432.1| cationic amino acid transporter [Populus trichocarpa] gi|222847690|gb|EEE85237.1| cationic amino acid transporter [Populus trichocarpa] Length = 577 Score = 56.2 bits (134), Expect(2) = 1e-11 Identities = 22/39 (56%), Positives = 30/39 (76%) Frame = +3 Query: 87 FVRFAICTGVMLVYYVFFGLHATYDVAHQKPLDLETAQG 203 F+RF IC+ VM++YY+ G+HATYDVAHQ P + E +G Sbjct: 538 FLRFIICSAVMILYYLMIGVHATYDVAHQNPKETEAEEG 576 Score = 38.1 bits (87), Expect(2) = 1e-11 Identities = 16/19 (84%), Positives = 17/19 (89%) Frame = +1 Query: 1 KVWGVPLVLWLPSFSIAIN 57 KVWGVPLV WLPS SIA+N Sbjct: 508 KVWGVPLVPWLPSLSIAMN 526