BLASTX nr result
ID: Coptis25_contig00025374
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00025374 (317 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003634649.1| PREDICTED: lactase-phlorizin hydrolase [Viti... 69 5e-10 emb|CBI20347.3| unnamed protein product [Vitis vinifera] 69 5e-10 gb|AFZ78536.1| beta-glucosidase [Populus tomentosa] 67 2e-09 gb|AFZ78535.1| beta-glucosidase [Populus tomentosa] 67 2e-09 ref|XP_002330984.1| predicted protein [Populus trichocarpa] gi|2... 67 2e-09 >ref|XP_003634649.1| PREDICTED: lactase-phlorizin hydrolase [Vitis vinifera] Length = 1032 Score = 68.6 bits (166), Expect = 5e-10 Identities = 29/39 (74%), Positives = 32/39 (82%) Frame = +1 Query: 1 FAWSLLDNFEWGTGYAIRFGIYYVDLKTLERLPKNSSNW 117 F WSLLDNFEW GY+IRFG+YYVD KTL R+PK SS W Sbjct: 464 FVWSLLDNFEWTNGYSIRFGLYYVDYKTLCRIPKFSSKW 502 Score = 60.5 bits (145), Expect = 1e-07 Identities = 25/39 (64%), Positives = 29/39 (74%) Frame = +1 Query: 1 FAWSLLDNFEWGTGYAIRFGIYYVDLKTLERLPKNSSNW 117 F WSL+DNFEW GY RFG+YYVD +TL R PK S+ W Sbjct: 964 FIWSLMDNFEWVYGYNTRFGLYYVDRQTLRRTPKLSARW 1002 >emb|CBI20347.3| unnamed protein product [Vitis vinifera] Length = 529 Score = 68.6 bits (166), Expect = 5e-10 Identities = 29/39 (74%), Positives = 32/39 (82%) Frame = +1 Query: 1 FAWSLLDNFEWGTGYAIRFGIYYVDLKTLERLPKNSSNW 117 F WSLLDNFEW GY+IRFG+YYVD KTL R+PK SS W Sbjct: 455 FVWSLLDNFEWTNGYSIRFGLYYVDYKTLCRIPKFSSKW 493 >gb|AFZ78536.1| beta-glucosidase [Populus tomentosa] Length = 519 Score = 67.0 bits (162), Expect = 2e-09 Identities = 28/40 (70%), Positives = 33/40 (82%), Gaps = 1/40 (2%) Frame = +1 Query: 1 FAWSLLDNFEWGTGYAIRFGIYYVDLKT-LERLPKNSSNW 117 FAWSL+DNFEWG+GYA+RFG+YYVD K L+R PK S W Sbjct: 438 FAWSLMDNFEWGSGYAVRFGLYYVDFKNDLKRYPKKSVKW 477 >gb|AFZ78535.1| beta-glucosidase [Populus tomentosa] Length = 519 Score = 66.6 bits (161), Expect = 2e-09 Identities = 28/40 (70%), Positives = 33/40 (82%), Gaps = 1/40 (2%) Frame = +1 Query: 1 FAWSLLDNFEWGTGYAIRFGIYYVDLKT-LERLPKNSSNW 117 FAWSL+DNFEWG+GYA+RFG+YYVD K L+R PK S W Sbjct: 438 FAWSLMDNFEWGSGYAVRFGLYYVDYKNDLKRYPKKSVKW 477 >ref|XP_002330984.1| predicted protein [Populus trichocarpa] gi|222872776|gb|EEF09907.1| predicted protein [Populus trichocarpa] Length = 519 Score = 66.6 bits (161), Expect = 2e-09 Identities = 28/40 (70%), Positives = 33/40 (82%), Gaps = 1/40 (2%) Frame = +1 Query: 1 FAWSLLDNFEWGTGYAIRFGIYYVDLKT-LERLPKNSSNW 117 FAWSL+DNFEWG+GYA+RFG+YYVD K L+R PK S W Sbjct: 438 FAWSLMDNFEWGSGYAVRFGLYYVDYKNDLKRYPKKSVKW 477