BLASTX nr result
ID: Coptis25_contig00024740
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00024740 (710 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002282998.1| PREDICTED: xylosyltransferase 1 [Vitis vinif... 80 3e-13 emb|CAN80510.1| hypothetical protein VITISV_043589 [Vitis vinifera] 80 3e-13 ref|XP_004157711.1| PREDICTED: xylosyltransferase 1-like [Cucumi... 77 3e-12 ref|XP_004134387.1| PREDICTED: xylosyltransferase-like [Cucumis ... 77 3e-12 ref|XP_002518166.1| transferase, transferring glycosyl groups, p... 75 2e-11 >ref|XP_002282998.1| PREDICTED: xylosyltransferase 1 [Vitis vinifera] gi|297741901|emb|CBI33336.3| unnamed protein product [Vitis vinifera] Length = 432 Score = 80.5 bits (197), Expect = 3e-13 Identities = 44/85 (51%), Positives = 53/85 (62%), Gaps = 2/85 (2%) Frame = -3 Query: 249 PYTIPK--HRQKLFFNNXXXXXXXXXXXXXXXXXIAYFISGSNNDTHRILRLLYSIYHPR 76 PY P HR +F N +AYFISGS D+H+ILRLL++ YHPR Sbjct: 58 PYLFPTSHHRHPIFLN------PNPSDSTPTPPSLAYFISGSAGDSHKILRLLFAAYHPR 111 Query: 75 NVYLLHLELTAPQSQREDLALAIQS 1 N YLLHL+LTAPQS R+ LALA+QS Sbjct: 112 NHYLLHLDLTAPQSDRDRLALAVQS 136 >emb|CAN80510.1| hypothetical protein VITISV_043589 [Vitis vinifera] Length = 459 Score = 80.5 bits (197), Expect = 3e-13 Identities = 44/85 (51%), Positives = 53/85 (62%), Gaps = 2/85 (2%) Frame = -3 Query: 249 PYTIPK--HRQKLFFNNXXXXXXXXXXXXXXXXXIAYFISGSNNDTHRILRLLYSIYHPR 76 PY P HR +F N +AYFISGS D+H+ILRLL++ YHPR Sbjct: 58 PYLFPTSHHRHPIFLN------PNPSDSTPTPPSLAYFISGSAGDSHKILRLLFAAYHPR 111 Query: 75 NVYLLHLELTAPQSQREDLALAIQS 1 N YLLHL+LTAPQS R+ LALA+QS Sbjct: 112 NHYLLHLDLTAPQSDRDRLALAVQS 136 >ref|XP_004157711.1| PREDICTED: xylosyltransferase 1-like [Cucumis sativus] Length = 445 Score = 77.0 bits (188), Expect = 3e-12 Identities = 35/50 (70%), Positives = 44/50 (88%) Frame = -3 Query: 150 AYFISGSNNDTHRILRLLYSIYHPRNVYLLHLELTAPQSQREDLALAIQS 1 AY ISGSN D+ RILRLL++ YHPRN YLLHL+L+APQS+R+ LALA++S Sbjct: 99 AYLISGSNGDSDRILRLLFATYHPRNHYLLHLDLSAPQSERDSLALAVES 148 >ref|XP_004134387.1| PREDICTED: xylosyltransferase-like [Cucumis sativus] Length = 470 Score = 77.0 bits (188), Expect = 3e-12 Identities = 35/50 (70%), Positives = 44/50 (88%) Frame = -3 Query: 150 AYFISGSNNDTHRILRLLYSIYHPRNVYLLHLELTAPQSQREDLALAIQS 1 AY ISGSN D+ RILRLL++ YHPRN YLLHL+L+APQS+R+ LALA++S Sbjct: 124 AYLISGSNGDSDRILRLLFAAYHPRNHYLLHLDLSAPQSERDSLALAVES 173 >ref|XP_002518166.1| transferase, transferring glycosyl groups, putative [Ricinus communis] gi|223542762|gb|EEF44299.1| transferase, transferring glycosyl groups, putative [Ricinus communis] Length = 438 Score = 74.7 bits (182), Expect = 2e-11 Identities = 36/50 (72%), Positives = 42/50 (84%) Frame = -3 Query: 150 AYFISGSNNDTHRILRLLYSIYHPRNVYLLHLELTAPQSQREDLALAIQS 1 AY ISGS +DT RILRLLY+ YHP+N YLLHL+ APQS+R+ LALAIQS Sbjct: 93 AYLISGSKSDTGRILRLLYATYHPKNQYLLHLDRFAPQSERDKLALAIQS 142