BLASTX nr result
ID: Coptis25_contig00024605
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00024605 (409 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002278627.2| PREDICTED: uncharacterized protein LOC100263... 73 3e-11 ref|XP_003552694.1| PREDICTED: uncharacterized protein LOC100788... 57 2e-06 ref|XP_002882326.1| predicted protein [Arabidopsis lyrata subsp.... 56 3e-06 ref|XP_003621884.1| hypothetical protein MTR_7g024560 [Medicago ... 56 3e-06 ref|NP_187052.4| uncharacterized protein [Arabidopsis thaliana] ... 55 6e-06 >ref|XP_002278627.2| PREDICTED: uncharacterized protein LOC100263308 [Vitis vinifera] gi|296086229|emb|CBI31670.3| unnamed protein product [Vitis vinifera] Length = 309 Score = 72.8 bits (177), Expect = 3e-11 Identities = 31/43 (72%), Positives = 38/43 (88%) Frame = +1 Query: 280 KDALMLSVDRKGFDVIGKVPSLTTKDEFGEYEWREYRFTFKEE 408 KDA +LS+DRKGFDV+GKVPS KD FGEY+W+E+RFTF+EE Sbjct: 237 KDAYVLSIDRKGFDVLGKVPSPPMKDGFGEYQWKEFRFTFREE 279 >ref|XP_003552694.1| PREDICTED: uncharacterized protein LOC100788957 [Glycine max] Length = 308 Score = 57.0 bits (136), Expect = 2e-06 Identities = 25/43 (58%), Positives = 31/43 (72%) Frame = +1 Query: 280 KDALMLSVDRKGFDVIGKVPSLTTKDEFGEYEWREYRFTFKEE 408 KDA + S+DRKGFDV+ KV S KD Y+W+E+RF FKEE Sbjct: 237 KDAYITSIDRKGFDVLAKVSSPVLKDGIDGYQWKEFRFMFKEE 279 >ref|XP_002882326.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297328166|gb|EFH58585.1| predicted protein [Arabidopsis lyrata subsp. lyrata] Length = 236 Score = 56.2 bits (134), Expect = 3e-06 Identities = 29/52 (55%), Positives = 41/52 (78%), Gaps = 3/52 (5%) Frame = +1 Query: 262 LFYLFV--KDALMLSVDRKGFDVIGKVPSLTTKDEFG-EYEWREYRFTFKEE 408 L+YL + +DA M+SVD+KGF ++GKVPS ++E G EY+WRE+RF F+EE Sbjct: 160 LYYLDINARDAYMVSVDKKGFHLLGKVPS---EEEAGDEYQWREFRFEFEEE 208 >ref|XP_003621884.1| hypothetical protein MTR_7g024560 [Medicago truncatula] gi|355496899|gb|AES78102.1| hypothetical protein MTR_7g024560 [Medicago truncatula] Length = 307 Score = 56.2 bits (134), Expect = 3e-06 Identities = 24/43 (55%), Positives = 32/43 (74%) Frame = +1 Query: 280 KDALMLSVDRKGFDVIGKVPSLTTKDEFGEYEWREYRFTFKEE 408 KDA + SVDRKGFDV+ KV +KD G+Y+W+E RF F++E Sbjct: 236 KDAYVTSVDRKGFDVLAKVTGPVSKDGVGQYQWKELRFMFEQE 278 >ref|NP_187052.4| uncharacterized protein [Arabidopsis thaliana] gi|332640505|gb|AEE74026.1| uncharacterized protein [Arabidopsis thaliana] Length = 304 Score = 55.1 bits (131), Expect = 6e-06 Identities = 27/51 (52%), Positives = 39/51 (76%), Gaps = 2/51 (3%) Frame = +1 Query: 262 LFYLFV--KDALMLSVDRKGFDVIGKVPSLTTKDEFGEYEWREYRFTFKEE 408 L++L + +DA M+SVDRKGF ++GKVPS ++ EY+WRE+RF F+EE Sbjct: 228 LYFLDINARDAYMVSVDRKGFHLLGKVPS--EQEAGDEYQWREFRFEFEEE 276