BLASTX nr result
ID: Coptis25_contig00024399
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00024399 (535 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AER13172.1| putative gag/pol polyprotein [Phaseolus vulgaris] 55 3e-11 emb|CAN61851.1| hypothetical protein VITISV_036278 [Vitis vinifera] 50 1e-09 emb|CAN75724.1| hypothetical protein VITISV_040386 [Vitis vinifera] 54 1e-09 emb|CAN82930.1| hypothetical protein VITISV_040770 [Vitis vinifera] 52 6e-09 emb|CAN77158.1| hypothetical protein VITISV_019025 [Vitis vinifera] 51 1e-08 >gb|AER13172.1| putative gag/pol polyprotein [Phaseolus vulgaris] Length = 1556 Score = 55.5 bits (132), Expect(2) = 3e-11 Identities = 26/57 (45%), Positives = 39/57 (68%) Frame = -2 Query: 246 YVLLSDGEKSMYY*DALESTDREKWLKAI*DEMSSLHKNHIYDLV*KPKGRKSSQEQ 76 YV L+D + Y +A+ES +++KWL A+ DEM SLH NH +DLV PK +K+ + + Sbjct: 746 YVTLTDEGEPECYLEAMESEEKKKWLDAMQDEMKSLHDNHTFDLVKLPKDKKALENR 802 Score = 37.4 bits (85), Expect(2) = 3e-11 Identities = 14/32 (43%), Positives = 24/32 (75%) Frame = -3 Query: 101 KEEKVLKNKWVFKVKHEDSNPHLRHKTHLVVK 6 K++K L+N+W+++VK E ++ R+K LVVK Sbjct: 794 KDKKALENRWIYRVKQESNSTSPRYKARLVVK 825 >emb|CAN61851.1| hypothetical protein VITISV_036278 [Vitis vinifera] Length = 973 Score = 50.1 bits (118), Expect(2) = 1e-09 Identities = 26/62 (41%), Positives = 42/62 (67%), Gaps = 2/62 (3%) Frame = -2 Query: 267 PTTY--VHAYVLLSDGEKSMYY*DALESTDREKWLKAI*DEMSSLHKNHIYDLV*KPKGR 94 P+T+ V YVLL++ + Y +A+ ++ KW+ A+ DEM SLH+NH ++LV PKG+ Sbjct: 601 PSTWYSVDDYVLLTNRGEPESYEEAMGVENKMKWVDAMQDEMKSLHENHSFELVKLPKGK 660 Query: 93 KS 88 K+ Sbjct: 661 KA 662 Score = 37.7 bits (86), Expect(2) = 1e-09 Identities = 16/32 (50%), Positives = 22/32 (68%) Frame = -3 Query: 101 KEEKVLKNKWVFKVKHEDSNPHLRHKTHLVVK 6 K +K LKN+WV++VK E+ R+K LVVK Sbjct: 658 KGKKALKNRWVYRVKQEEHTSQPRYKARLVVK 689 >emb|CAN75724.1| hypothetical protein VITISV_040386 [Vitis vinifera] Length = 885 Score = 53.5 bits (127), Expect(2) = 1e-09 Identities = 29/74 (39%), Positives = 47/74 (63%), Gaps = 2/74 (2%) Frame = -2 Query: 303 EIRERKTIFNQVPTTY--VHAYVLLSDGEKSMYY*DALESTDREKWLKAI*DEMSSLHKN 130 +I R++ +Q P+T V YVLL+DG + Y +A+ ++ KW+ A+ DEM LH+N Sbjct: 567 DIPLRRSTRDQHPSTRHSVDDYVLLTDGGEPESYEEAMGDENKIKWVDAMQDEMKPLHEN 626 Query: 129 HIYDLV*KPKGRKS 88 H Y+LV P G+++ Sbjct: 627 HSYELVKLPNGKRA 640 Score = 34.3 bits (77), Expect(2) = 1e-09 Identities = 14/30 (46%), Positives = 21/30 (70%) Frame = -3 Query: 95 EKVLKNKWVFKVKHEDSNPHLRHKTHLVVK 6 ++ LKN+WV++VK E+ R+K LVVK Sbjct: 638 KRALKNRWVYRVKQEEHASXPRYKARLVVK 667 >emb|CAN82930.1| hypothetical protein VITISV_040770 [Vitis vinifera] Length = 214 Score = 51.6 bits (122), Expect(2) = 6e-09 Identities = 21/53 (39%), Positives = 37/53 (69%) Frame = -2 Query: 246 YVLLSDGEKSMYY*DALESTDREKWLKAI*DEMSSLHKNHIYDLV*KPKGRKS 88 YV+ +DGE+ + +A+ES + +W++A DEM SLH NH ++L+ KG+++ Sbjct: 132 YVMFTDGEEPESFEEAIESEQKREWIEAFQDEMKSLHDNHTFELMKLSKGKRA 184 Score = 33.5 bits (75), Expect(2) = 6e-09 Identities = 14/32 (43%), Positives = 20/32 (62%) Frame = -3 Query: 101 KEEKVLKNKWVFKVKHEDSNPHLRHKTHLVVK 6 K ++ LKNKW +KVK E+ R+K L +K Sbjct: 180 KGKRALKNKWEYKVKQEEHTSCPRYKARLAIK 211 >emb|CAN77158.1| hypothetical protein VITISV_019025 [Vitis vinifera] Length = 788 Score = 50.8 bits (120), Expect(2) = 1e-08 Identities = 21/53 (39%), Positives = 38/53 (71%) Frame = -2 Query: 246 YVLLSDGEKSMYY*DALESTDREKWLKAI*DEMSSLHKNHIYDLV*KPKGRKS 88 Y+L S+G +S Y + L ++++WL+A+ +EM S HKN+ Y+L+ PKG+++ Sbjct: 456 YLLFSBGGESXNYQEVLLHDEKKEWLRAMHEEMKSFHKNNTYELMELPKGKRA 508 Score = 33.1 bits (74), Expect(2) = 1e-08 Identities = 16/32 (50%), Positives = 20/32 (62%) Frame = -3 Query: 101 KEEKVLKNKWVFKVKHEDSNPHLRHKTHLVVK 6 K ++ LKNKWV K K E + R+K LVVK Sbjct: 504 KGKRALKNKWVLKRKPEPNXSQPRYKXRLVVK 535