BLASTX nr result
ID: Coptis25_contig00024396
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00024396 (241 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002439188.1| hypothetical protein SORBIDRAFT_09g001966 [S... 55 6e-06 >ref|XP_002439188.1| hypothetical protein SORBIDRAFT_09g001966 [Sorghum bicolor] gi|241944473|gb|EES17618.1| hypothetical protein SORBIDRAFT_09g001966 [Sorghum bicolor] Length = 338 Score = 55.1 bits (131), Expect = 6e-06 Identities = 27/59 (45%), Positives = 37/59 (62%) Frame = -2 Query: 192 KYTHLPAIGLSGGILIAWNSDIMDVTYELHGAFSLSVECTMKINGFSCLLTSVYGPNSN 16 ++ +LPA GG+L+AWN D++ FSLSV TM++ S LLTSVYGPN + Sbjct: 205 QFEYLPAEHTRGGVLVAWNWDLICAGVTSKKRFSLSVNLTMRMTNASFLLTSVYGPNED 263