BLASTX nr result
ID: Coptis25_contig00024180
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00024180 (226 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002528967.1| Triacylglycerol lipase 2 precursor, putative... 60 2e-07 ref|XP_002276007.2| PREDICTED: triacylglycerol lipase 2 [Vitis v... 56 4e-06 emb|CBI28873.3| unnamed protein product [Vitis vinifera] 56 4e-06 gb|ABK21132.1| unknown [Picea sitchensis] 55 6e-06 >ref|XP_002528967.1| Triacylglycerol lipase 2 precursor, putative [Ricinus communis] gi|223531613|gb|EEF33441.1| Triacylglycerol lipase 2 precursor, putative [Ricinus communis] Length = 485 Score = 60.1 bits (144), Expect = 2e-07 Identities = 32/45 (71%), Positives = 36/45 (80%), Gaps = 4/45 (8%) Frame = -1 Query: 124 MNRFR-KAEILVG---VPNLKRKALNSWSAVQDTYFSTKDVFERH 2 M RFR K L+G VP+LK+KALNSWSAVQDTY STKD+FERH Sbjct: 1 MQRFRSKGTTLLGYLAVPHLKKKALNSWSAVQDTYSSTKDLFERH 45 >ref|XP_002276007.2| PREDICTED: triacylglycerol lipase 2 [Vitis vinifera] Length = 612 Score = 55.8 bits (133), Expect = 4e-06 Identities = 24/29 (82%), Positives = 27/29 (93%) Frame = -1 Query: 88 VPNLKRKALNSWSAVQDTYFSTKDVFERH 2 VP+LK+KA+NSWSAVQDTY STKD FERH Sbjct: 17 VPHLKKKAMNSWSAVQDTYHSTKDTFERH 45 >emb|CBI28873.3| unnamed protein product [Vitis vinifera] Length = 197 Score = 55.8 bits (133), Expect = 4e-06 Identities = 24/29 (82%), Positives = 27/29 (93%) Frame = -1 Query: 88 VPNLKRKALNSWSAVQDTYFSTKDVFERH 2 VP+LK+KA+NSWSAVQDTY STKD FERH Sbjct: 17 VPHLKKKAMNSWSAVQDTYHSTKDTFERH 45 >gb|ABK21132.1| unknown [Picea sitchensis] Length = 192 Score = 55.1 bits (131), Expect = 6e-06 Identities = 22/30 (73%), Positives = 28/30 (93%) Frame = -1 Query: 91 GVPNLKRKALNSWSAVQDTYFSTKDVFERH 2 G+P LKR+A N+W+AVQDT++STKDVFERH Sbjct: 17 GIPQLKRRASNTWAAVQDTFYSTKDVFERH 46