BLASTX nr result
ID: Coptis25_contig00024170
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00024170 (283 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002527490.1| conserved hypothetical protein [Ricinus comm... 61 8e-08 >ref|XP_002527490.1| conserved hypothetical protein [Ricinus communis] gi|223533130|gb|EEF34888.1| conserved hypothetical protein [Ricinus communis] Length = 60 Score = 61.2 bits (147), Expect = 8e-08 Identities = 30/58 (51%), Positives = 37/58 (63%) Frame = +1 Query: 88 WLARSKLRAGQYGSGERLIHMGPKEKGTTSGWSHRAAFTFRS*PWEDNRPVPHGSLKS 261 WLARSKLR G GE MGP+ +GT GW HRAA T S W+DN PV G++++ Sbjct: 3 WLARSKLRVDPCGLGEGPGSMGPRAEGTALGWFHRAAITSLSWQWKDNGPVLPGAIEA 60