BLASTX nr result
ID: Coptis25_contig00024062
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00024062 (309 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002511313.1| pentatricopeptide repeat-containing protein,... 86 2e-15 ref|XP_002321639.1| predicted protein [Populus trichocarpa] gi|2... 82 4e-14 ref|XP_002277390.1| PREDICTED: pentatricopeptide repeat-containi... 80 2e-13 ref|XP_004138087.1| PREDICTED: pentatricopeptide repeat-containi... 77 1e-12 ref|XP_003550712.1| PREDICTED: pentatricopeptide repeat-containi... 74 9e-12 >ref|XP_002511313.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223550428|gb|EEF51915.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 627 Score = 86.3 bits (212), Expect = 2e-15 Identities = 42/99 (42%), Positives = 57/99 (57%) Frame = +1 Query: 1 VLVNGLCSKGRVDGAYSLVLETVKKVNMRPLLDTYKNLIQNXXXXXXXXXXXXXXXQMKI 180 VL+N S+ R+DGAY+L ++ V K +RP TYK LI+ MK Sbjct: 480 VLINAFLSQKRIDGAYTLFMDMVDKARLRPWQATYKLLIEKLLEVRKLEEALNLLRLMKQ 539 Query: 181 HEFPPFEEPFYDYISKFGMVDDAIDYFTALRIRKHPTNS 297 H PPF EPF YIS+FG VDDA D+ AL ++++P+ S Sbjct: 540 HNHPPFPEPFVQYISRFGTVDDAADFLKALSVKEYPSTS 578 >ref|XP_002321639.1| predicted protein [Populus trichocarpa] gi|222868635|gb|EEF05766.1| predicted protein [Populus trichocarpa] Length = 476 Score = 82.0 bits (201), Expect = 4e-14 Identities = 39/98 (39%), Positives = 59/98 (60%) Frame = +1 Query: 1 VLVNGLCSKGRVDGAYSLVLETVKKVNMRPLLDTYKNLIQNXXXXXXXXXXXXXXXQMKI 180 VLV G S+ ++DGAY+ ++E V K+ + P TYK LI+ MK Sbjct: 329 VLVKGFLSQRKMDGAYTFLVEMVNKLRLVPWQATYKLLIEKLLQVRKLEEATDLLRLMKK 388 Query: 181 HEFPPFEEPFYDYISKFGMVDDAIDYFTALRIRKHPTN 294 H +PPF EPF YISKFG V+DA+++F L ++++P++ Sbjct: 389 HNYPPFPEPFDQYISKFGTVEDAVNFFKVLSVKEYPSS 426 >ref|XP_002277390.1| PREDICTED: pentatricopeptide repeat-containing protein At3g48250, chloroplastic-like [Vitis vinifera] Length = 631 Score = 80.1 bits (196), Expect = 2e-13 Identities = 40/99 (40%), Positives = 56/99 (56%) Frame = +1 Query: 1 VLVNGLCSKGRVDGAYSLVLETVKKVNMRPLLDTYKNLIQNXXXXXXXXXXXXXXXQMKI 180 VL+NG S+ R+DGAY L++E V ++ P TYK +I MK Sbjct: 482 VLINGFLSQKRIDGAYKLLVEMVNTAHLVPWQATYKLMINKLLGVRKLEEAINLLHLMKK 541 Query: 181 HEFPPFEEPFYDYISKFGMVDDAIDYFTALRIRKHPTNS 297 +PPF EPF +YISKFG V+DA ++ AL +K+P+ S Sbjct: 542 QNYPPFPEPFIEYISKFGTVEDAGEFLNALSAKKYPSQS 580 >ref|XP_004138087.1| PREDICTED: pentatricopeptide repeat-containing protein At3g48250, chloroplastic-like [Cucumis sativus] gi|449524136|ref|XP_004169079.1| PREDICTED: pentatricopeptide repeat-containing protein At3g48250, chloroplastic-like [Cucumis sativus] Length = 632 Score = 77.0 bits (188), Expect = 1e-12 Identities = 38/99 (38%), Positives = 56/99 (56%) Frame = +1 Query: 1 VLVNGLCSKGRVDGAYSLVLETVKKVNMRPLLDTYKNLIQNXXXXXXXXXXXXXXXQMKI 180 VL++G ++ +++GAY L++E K ++RP TYK LI+N MK Sbjct: 475 VLISGFLNQKKLNGAYQLLIELTNKAHVRPWQATYKQLIKNLLEVRKLEEAIALLRLMKK 534 Query: 181 HEFPPFEEPFYDYISKFGMVDDAIDYFTALRIRKHPTNS 297 +PPF EPF YISKFG V DA D+ L +++P+ S Sbjct: 535 QNYPPFPEPFVQYISKFGTVQDADDFLKVLSSKEYPSVS 573 >ref|XP_003550712.1| PREDICTED: pentatricopeptide repeat-containing protein At3g48250, chloroplastic-like [Glycine max] Length = 635 Score = 74.3 bits (181), Expect = 9e-12 Identities = 37/98 (37%), Positives = 53/98 (54%) Frame = +1 Query: 1 VLVNGLCSKGRVDGAYSLVLETVKKVNMRPLLDTYKNLIQNXXXXXXXXXXXXXXXQMKI 180 VL +G S+ R++GAY LV E +K + P TYK LI+ MK Sbjct: 481 VLADGFLSQKRIEGAYELVAEISRKCRISPWQATYKKLIEKLLGVMKFEEALELLRLMKS 540 Query: 181 HEFPPFEEPFYDYISKFGMVDDAIDYFTALRIRKHPTN 294 H +PP+ PF YISKFG V+DA + AL ++ +P++ Sbjct: 541 HNYPPYHLPFVPYISKFGSVEDAEAFLKALSVKSYPSH 578