BLASTX nr result
ID: Coptis25_contig00024045
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00024045 (505 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_564521.1| dolichyl-phosphate mannosyltransferase polypept... 93 2e-17 ref|XP_002891413.1| hypothetical protein ARALYDRAFT_314249 [Arab... 93 3e-17 ref|XP_002514698.1| conserved hypothetical protein [Ricinus comm... 90 7e-17 gb|AFK45261.1| unknown [Medicago truncatula] 89 4e-16 ref|XP_002303057.1| predicted protein [Populus trichocarpa] gi|2... 89 4e-16 >ref|NP_564521.1| dolichyl-phosphate mannosyltransferase polypeptide 3 [Arabidopsis thaliana] gi|21553435|gb|AAM62528.1| unknown [Arabidopsis thaliana] gi|26451193|dbj|BAC42700.1| unknown protein [Arabidopsis thaliana] gi|28973443|gb|AAO64046.1| unknown protein [Arabidopsis thaliana] gi|332194132|gb|AEE32253.1| dolichyl-phosphate mannosyltransferase polypeptide 3 [Arabidopsis thaliana] Length = 89 Score = 93.2 bits (230), Expect = 2e-17 Identities = 42/54 (77%), Positives = 49/54 (90%) Frame = -3 Query: 221 PIYLIVSLGCYGLLIVGVGLMRFPTCPLEAGLLQKDVAEARDFLKQRGVDVGSD 60 PIY +VSLGCYGLL+VGVGLM+FPTCP EA LLQKD+AEA+DF K +GVDVGS+ Sbjct: 36 PIYFVVSLGCYGLLMVGVGLMQFPTCPQEAVLLQKDIAEAKDFFKHKGVDVGSN 89 >ref|XP_002891413.1| hypothetical protein ARALYDRAFT_314249 [Arabidopsis lyrata subsp. lyrata] gi|297337255|gb|EFH67672.1| hypothetical protein ARALYDRAFT_314249 [Arabidopsis lyrata subsp. lyrata] Length = 89 Score = 92.8 bits (229), Expect = 3e-17 Identities = 41/54 (75%), Positives = 49/54 (90%) Frame = -3 Query: 221 PIYLIVSLGCYGLLIVGVGLMRFPTCPLEAGLLQKDVAEARDFLKQRGVDVGSD 60 PIY +VSLGCYGLL+VG+GLM+FPTCP EA LLQKD+AEA+DF K +GVDVGS+ Sbjct: 36 PIYFVVSLGCYGLLMVGIGLMQFPTCPQEAVLLQKDIAEAKDFFKHKGVDVGSN 89 >ref|XP_002514698.1| conserved hypothetical protein [Ricinus communis] gi|223546302|gb|EEF47804.1| conserved hypothetical protein [Ricinus communis] Length = 82 Score = 89.7 bits (221), Expect(2) = 7e-17 Identities = 40/54 (74%), Positives = 48/54 (88%) Frame = -3 Query: 221 PIYLIVSLGCYGLLIVGVGLMRFPTCPLEAGLLQKDVAEARDFLKQRGVDVGSD 60 PIY I+SLGCYGLL+VG+GLM+FPTCP EA LLQ+D+ EA+ FLKQ+GVDV SD Sbjct: 29 PIYFIISLGCYGLLMVGIGLMQFPTCPQEAILLQQDIVEAKGFLKQKGVDVSSD 82 Score = 22.3 bits (46), Expect(2) = 7e-17 Identities = 8/9 (88%), Positives = 9/9 (100%) Frame = -2 Query: 369 FWIGLLETS 343 FWIGLL+TS Sbjct: 10 FWIGLLQTS 18 >gb|AFK45261.1| unknown [Medicago truncatula] Length = 89 Score = 89.0 bits (219), Expect = 4e-16 Identities = 40/53 (75%), Positives = 47/53 (88%) Frame = -3 Query: 221 PIYLIVSLGCYGLLIVGVGLMRFPTCPLEAGLLQKDVAEARDFLKQRGVDVGS 63 PIY +VSLGCYGLL+VGVGLM FPTCP EA LLQKD+ EA+++LKQRGVDV + Sbjct: 36 PIYFVVSLGCYGLLMVGVGLMNFPTCPQEALLLQKDIVEAKEYLKQRGVDVST 88 >ref|XP_002303057.1| predicted protein [Populus trichocarpa] gi|222844783|gb|EEE82330.1| predicted protein [Populus trichocarpa] Length = 89 Score = 89.0 bits (219), Expect = 4e-16 Identities = 40/54 (74%), Positives = 48/54 (88%) Frame = -3 Query: 221 PIYLIVSLGCYGLLIVGVGLMRFPTCPLEAGLLQKDVAEARDFLKQRGVDVGSD 60 PIY ++SLGCYGLL+VGVGLM FPTCP EA LLQ+D+ EA+DFLK+RGVDV S+ Sbjct: 36 PIYFVISLGCYGLLMVGVGLMNFPTCPQEALLLQQDIVEAKDFLKRRGVDVVSE 89