BLASTX nr result
ID: Coptis25_contig00023854
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00023854 (567 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002275680.2| PREDICTED: pentatricopeptide repeat-containi... 87 2e-15 ref|XP_002520999.1| pentatricopeptide repeat-containing protein,... 77 2e-12 ref|XP_004167184.1| PREDICTED: pentatricopeptide repeat-containi... 70 3e-10 ref|XP_004148968.1| PREDICTED: pentatricopeptide repeat-containi... 70 3e-10 ref|XP_004151739.1| PREDICTED: pentatricopeptide repeat-containi... 62 7e-08 >ref|XP_002275680.2| PREDICTED: pentatricopeptide repeat-containing protein At3g22470, mitochondrial-like [Vitis vinifera] gi|297735515|emb|CBI17955.3| unnamed protein product [Vitis vinifera] Length = 627 Score = 87.0 bits (214), Expect = 2e-15 Identities = 44/67 (65%), Positives = 54/67 (80%), Gaps = 1/67 (1%) Frame = -1 Query: 567 GVAPNVVTFNTLMRGFL-NEEPQKVVQHLHKMRDKNLRPDASTAAIVIELLSKDEKSREY 391 G APN+VTFNTLMRGF N+E QKVV+ L +M +K+ PDAST +IV++LLSKDEK REY Sbjct: 548 GCAPNLVTFNTLMRGFCQNDEMQKVVELLQEMAEKDFSPDASTISIVVDLLSKDEKYREY 607 Query: 390 LNSFPTF 370 L+ PTF Sbjct: 608 LHLLPTF 614 >ref|XP_002520999.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223539836|gb|EEF41416.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 628 Score = 77.4 bits (189), Expect = 2e-12 Identities = 41/67 (61%), Positives = 47/67 (70%), Gaps = 1/67 (1%) Frame = -1 Query: 567 GVAPNVVTFNTLMRGF-LNEEPQKVVQHLHKMRDKNLRPDASTAAIVIELLSKDEKSREY 391 G APNVVTFNTLMRG LN E K+V+ LHKM + L PDAST IV+++L KDE E Sbjct: 556 GCAPNVVTFNTLMRGLCLNSERPKIVELLHKMAARKLSPDASTLLIVMDILLKDENYHEC 615 Query: 390 LNSFPTF 370 LN PTF Sbjct: 616 LNLLPTF 622 >ref|XP_004167184.1| PREDICTED: pentatricopeptide repeat-containing protein At3g22470, mitochondrial-like [Cucumis sativus] Length = 605 Score = 69.7 bits (169), Expect = 3e-10 Identities = 33/67 (49%), Positives = 48/67 (71%), Gaps = 1/67 (1%) Frame = -1 Query: 567 GVAPNVVTFNTLMRGFLNEEP-QKVVQHLHKMRDKNLRPDASTAAIVIELLSKDEKSREY 391 G P+++T+NTLMRGF ++VVQ LH+M K++ PDA T +IV+++LSKDEK +E Sbjct: 525 GCTPDIITYNTLMRGFYESNKLEEVVQLLHRMAQKDVSPDAITCSIVVDMLSKDEKYQEC 584 Query: 390 LNSFPTF 370 L+ P F Sbjct: 585 LHLLPRF 591 >ref|XP_004148968.1| PREDICTED: pentatricopeptide repeat-containing protein At3g22470, mitochondrial-like [Cucumis sativus] Length = 580 Score = 69.7 bits (169), Expect = 3e-10 Identities = 33/67 (49%), Positives = 48/67 (71%), Gaps = 1/67 (1%) Frame = -1 Query: 567 GVAPNVVTFNTLMRGFLNEEP-QKVVQHLHKMRDKNLRPDASTAAIVIELLSKDEKSREY 391 G P+++T+NTLMRGF ++VVQ LH+M K++ PDA T +IV+++LSKDEK +E Sbjct: 500 GCTPDIITYNTLMRGFYESNKLEEVVQLLHRMAQKDVSPDAITCSIVVDMLSKDEKYQEC 559 Query: 390 LNSFPTF 370 L+ P F Sbjct: 560 LHLLPRF 566 >ref|XP_004151739.1| PREDICTED: pentatricopeptide repeat-containing protein At3g22470, mitochondrial-like [Cucumis sativus] Length = 225 Score = 62.0 bits (149), Expect = 7e-08 Identities = 30/73 (41%), Positives = 50/73 (68%), Gaps = 1/73 (1%) Frame = -1 Query: 567 GVAPNVVTFNTLMRGFL-NEEPQKVVQHLHKMRDKNLRPDASTAAIVIELLSKDEKSREY 391 G P+++T+NTL+ GF + + +VV+ LHKM +++ PDA + IVI++L KDEK +E Sbjct: 151 GCTPDIITYNTLLCGFCQSNKSDEVVKLLHKMIQRDMSPDAISCNIVIDMLRKDEKYQEC 210 Query: 390 LNSFPTFLPEHKQ 352 L+ P FL + ++ Sbjct: 211 LDLLPRFLVQERR 223