BLASTX nr result
ID: Coptis25_contig00023571
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00023571 (201 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003533326.1| PREDICTED: uncharacterized protein LOC100779... 60 2e-07 ref|XP_003533335.1| PREDICTED: pentatricopeptide repeat-containi... 59 3e-07 ref|XP_003533330.1| PREDICTED: putative pentatricopeptide repeat... 59 3e-07 ref|XP_003533328.1| PREDICTED: pentatricopeptide repeat-containi... 59 3e-07 ref|XP_003533312.1| PREDICTED: putative pentatricopeptide repeat... 59 3e-07 >ref|XP_003533326.1| PREDICTED: uncharacterized protein LOC100779660 [Glycine max] Length = 1205 Score = 59.7 bits (143), Expect = 2e-07 Identities = 26/42 (61%), Positives = 33/42 (78%) Frame = +3 Query: 3 GIQPDIFTLCTLINCYSNMGRPDFGFAILASILKRGFEPDAV 128 GIQPD+FTL LINC+ +MG+ F F+ILA ILKRG+ PD + Sbjct: 956 GIQPDLFTLNILINCFCHMGQITFNFSILAKILKRGYHPDTI 997 Score = 59.3 bits (142), Expect = 3e-07 Identities = 26/42 (61%), Positives = 33/42 (78%) Frame = +3 Query: 3 GIQPDIFTLCTLINCYSNMGRPDFGFAILASILKRGFEPDAV 128 GIQPD+ TL LINC+ +MG+ FGF++LA ILKRG+ PD V Sbjct: 89 GIQPDLITLNILINCFCHMGQITFGFSVLAKILKRGYPPDTV 130 >ref|XP_003533335.1| PREDICTED: pentatricopeptide repeat-containing protein At1g62670, mitochondrial-like [Glycine max] Length = 794 Score = 59.3 bits (142), Expect = 3e-07 Identities = 26/42 (61%), Positives = 33/42 (78%) Frame = +3 Query: 3 GIQPDIFTLCTLINCYSNMGRPDFGFAILASILKRGFEPDAV 128 GIQPD+FTL LINC+ +MG+ FGF++LA ILKRG+ P V Sbjct: 337 GIQPDLFTLNILINCFCHMGQITFGFSVLAKILKRGYPPSTV 378 >ref|XP_003533330.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial-like [Glycine max] Length = 546 Score = 59.3 bits (142), Expect = 3e-07 Identities = 26/42 (61%), Positives = 33/42 (78%) Frame = +3 Query: 3 GIQPDIFTLCTLINCYSNMGRPDFGFAILASILKRGFEPDAV 128 GIQPD+ TL LINC+ +MG+ FGF++LA ILKRG+ PD V Sbjct: 89 GIQPDLITLNILINCFCHMGQITFGFSVLAKILKRGYPPDTV 130 >ref|XP_003533328.1| PREDICTED: pentatricopeptide repeat-containing protein At1g12775, mitochondrial-like [Glycine max] Length = 447 Score = 59.3 bits (142), Expect = 3e-07 Identities = 26/42 (61%), Positives = 33/42 (78%) Frame = +3 Query: 3 GIQPDIFTLCTLINCYSNMGRPDFGFAILASILKRGFEPDAV 128 GIQPD+FTL LINC+ +MG+ FGF++LA ILKRG+ P V Sbjct: 88 GIQPDLFTLNILINCFCHMGQITFGFSVLAKILKRGYPPSTV 129 >ref|XP_003533312.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial-like [Glycine max] Length = 546 Score = 59.3 bits (142), Expect = 3e-07 Identities = 26/42 (61%), Positives = 33/42 (78%) Frame = +3 Query: 3 GIQPDIFTLCTLINCYSNMGRPDFGFAILASILKRGFEPDAV 128 GIQPD+ TL LINC+ +MG+ FGF++LA ILKRG+ PD V Sbjct: 89 GIQPDLITLNILINCFCHMGQITFGFSVLAKILKRGYPPDTV 130