BLASTX nr result
ID: Coptis25_contig00023322
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00023322 (227 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAE99968.1| hypothetical protein [Arabidopsis thaliana] 78 7e-13 ref|NP_567662.1| OSBP(oxysterol binding protein)-related protein... 78 7e-13 emb|CAA22159.1| putative protein [Arabidopsis thaliana] gi|72691... 78 7e-13 ref|XP_002867764.1| oxysterol-binding family protein [Arabidopsi... 76 3e-12 ref|XP_002266999.2| PREDICTED: oxysterol-binding protein-related... 72 4e-11 >dbj|BAE99968.1| hypothetical protein [Arabidopsis thaliana] Length = 143 Score = 78.2 bits (191), Expect = 7e-13 Identities = 40/64 (62%), Positives = 47/64 (73%), Gaps = 7/64 (10%) Frame = +1 Query: 55 LYKWTNFSKGWRSRWFLVKNGVVSYSKIPRSENF-----DSDVRVIGD--DVRLTRVCSS 213 LYKWTNF KGWRSRWFL++NG++SYSKI R EN D DVR+IGD RL+R+ S Sbjct: 57 LYKWTNFGKGWRSRWFLLRNGILSYSKIRRPENLNLLSPDDDVRLIGDISGERLSRMDSC 116 Query: 214 SRRR 225 S RR Sbjct: 117 SGRR 120 >ref|NP_567662.1| OSBP(oxysterol binding protein)-related protein 2A [Arabidopsis thaliana] gi|75163969|sp|Q940Y1.1|ORP2A_ARATH RecName: Full=Oxysterol-binding protein-related protein 2A; AltName: Full=OSBP-related protein 2A gi|15450519|gb|AAK96552.1| AT4g22540/F7K2_120 [Arabidopsis thaliana] gi|24111447|gb|AAN46892.1| At4g22540/F7K2_120 [Arabidopsis thaliana] gi|332659220|gb|AEE84620.1| OSBP(oxysterol binding protein)-related protein 2A [Arabidopsis thaliana] Length = 721 Score = 78.2 bits (191), Expect = 7e-13 Identities = 40/64 (62%), Positives = 47/64 (73%), Gaps = 7/64 (10%) Frame = +1 Query: 55 LYKWTNFSKGWRSRWFLVKNGVVSYSKIPRSENF-----DSDVRVIGD--DVRLTRVCSS 213 LYKWTNF KGWRSRWFL++NG++SYSKI R EN D DVR+IGD RL+R+ S Sbjct: 57 LYKWTNFGKGWRSRWFLLRNGILSYSKIRRPENLNLLSPDDDVRLIGDISGERLSRMDSC 116 Query: 214 SRRR 225 S RR Sbjct: 117 SGRR 120 >emb|CAA22159.1| putative protein [Arabidopsis thaliana] gi|7269100|emb|CAB79209.1| putative protein [Arabidopsis thaliana] Length = 732 Score = 78.2 bits (191), Expect = 7e-13 Identities = 40/64 (62%), Positives = 47/64 (73%), Gaps = 7/64 (10%) Frame = +1 Query: 55 LYKWTNFSKGWRSRWFLVKNGVVSYSKIPRSENF-----DSDVRVIGD--DVRLTRVCSS 213 LYKWTNF KGWRSRWFL++NG++SYSKI R EN D DVR+IGD RL+R+ S Sbjct: 57 LYKWTNFGKGWRSRWFLLRNGILSYSKIRRPENLNLLSPDDDVRLIGDISGERLSRMDSC 116 Query: 214 SRRR 225 S RR Sbjct: 117 SGRR 120 >ref|XP_002867764.1| oxysterol-binding family protein [Arabidopsis lyrata subsp. lyrata] gi|297313600|gb|EFH44023.1| oxysterol-binding family protein [Arabidopsis lyrata subsp. lyrata] Length = 721 Score = 76.3 bits (186), Expect = 3e-12 Identities = 39/64 (60%), Positives = 47/64 (73%), Gaps = 7/64 (10%) Frame = +1 Query: 55 LYKWTNFSKGWRSRWFLVKNGVVSYSKIPRSENFD-----SDVRVIGD--DVRLTRVCSS 213 LYKWTNF KGWRSRWFL++NG++SYSKI R EN + DVR+IGD RL+R+ S Sbjct: 62 LYKWTNFGKGWRSRWFLLRNGILSYSKIRRPENLNLLSPSDDVRLIGDISGERLSRMDSC 121 Query: 214 SRRR 225 S RR Sbjct: 122 SGRR 125 >ref|XP_002266999.2| PREDICTED: oxysterol-binding protein-related protein 2A-like [Vitis vinifera] Length = 698 Score = 72.4 bits (176), Expect = 4e-11 Identities = 37/64 (57%), Positives = 45/64 (70%), Gaps = 7/64 (10%) Frame = +1 Query: 55 LYKWTNFSKGWRSRWFLVKNGVVSYSKIPRSENFD-----SDVRVIGD--DVRLTRVCSS 213 LYKWTN+ KGWRSRWFL++NGV+SYSKI R E+ D+RVIGD RL+R+ S Sbjct: 56 LYKWTNYGKGWRSRWFLLRNGVLSYSKIRRPESLHLPSPADDIRVIGDVSTSRLSRLDSG 115 Query: 214 SRRR 225 RR Sbjct: 116 GGRR 119