BLASTX nr result
ID: Coptis25_contig00023144
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00023144 (480 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002519145.1| DNA binding protein, putative [Ricinus commu... 55 8e-06 >ref|XP_002519145.1| DNA binding protein, putative [Ricinus communis] gi|223541808|gb|EEF43356.1| DNA binding protein, putative [Ricinus communis] Length = 333 Score = 54.7 bits (130), Expect = 8e-06 Identities = 27/61 (44%), Positives = 43/61 (70%), Gaps = 1/61 (1%) Frame = -3 Query: 478 LTLMTSDGHKRLVGCRVYKGHSAQITEGWKMFAEENHLRVGDVCVFEMIK-KDLFLKVHI 302 + L +SDG + V C +Y+G A++++GW F EN++ GDVCVFE++K +D+ LKV + Sbjct: 254 IKLQSSDGKQWPVRC-LYRGGRAKLSQGWYEFTLENNMGEGDVCVFELLKSRDIVLKVTV 312 Query: 301 F 299 F Sbjct: 313 F 313