BLASTX nr result
ID: Coptis25_contig00023055
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00023055 (363 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002301410.1| predicted protein [Populus trichocarpa] gi|2... 114 6e-24 ref|XP_002263519.1| PREDICTED: uncharacterized membrane protein ... 114 8e-24 emb|CAN71954.1| hypothetical protein VITISV_024312 [Vitis vinifera] 114 8e-24 ref|XP_002876638.1| hypothetical protein ARALYDRAFT_907735 [Arab... 111 7e-23 emb|CAB71107.1| putative protein [Arabidopsis thaliana] 110 1e-22 >ref|XP_002301410.1| predicted protein [Populus trichocarpa] gi|222843136|gb|EEE80683.1| predicted protein [Populus trichocarpa] Length = 175 Score = 114 bits (286), Expect = 6e-24 Identities = 54/60 (90%), Positives = 57/60 (95%) Frame = +3 Query: 3 RRHAGMQAEVLNMIIADLFQGHPISQRKLKELLGHTPSQVLAGAVLGILVACICCQGSLV 182 RRHAGMQAEVLNMI+ DLFQGHPISQRKLKELLGH PSQVLAGA+LGILVAC+CCQG LV Sbjct: 114 RRHAGMQAEVLNMIVEDLFQGHPISQRKLKELLGHNPSQVLAGALLGILVACVCCQGCLV 173 >ref|XP_002263519.1| PREDICTED: uncharacterized membrane protein yuiD [Vitis vinifera] gi|297745470|emb|CBI40550.3| unnamed protein product [Vitis vinifera] Length = 252 Score = 114 bits (285), Expect = 8e-24 Identities = 53/60 (88%), Positives = 58/60 (96%) Frame = +3 Query: 3 RRHAGMQAEVLNMIIADLFQGHPISQRKLKELLGHTPSQVLAGAVLGILVACICCQGSLV 182 RRHAGMQAEVLNMI+ DLF+GHPISQRKLKE+LGHTPSQVLAGAVLGI++ACICCQG LV Sbjct: 191 RRHAGMQAEVLNMIVEDLFKGHPISQRKLKEILGHTPSQVLAGAVLGIVIACICCQGCLV 250 >emb|CAN71954.1| hypothetical protein VITISV_024312 [Vitis vinifera] Length = 185 Score = 114 bits (285), Expect = 8e-24 Identities = 53/60 (88%), Positives = 58/60 (96%) Frame = +3 Query: 3 RRHAGMQAEVLNMIIADLFQGHPISQRKLKELLGHTPSQVLAGAVLGILVACICCQGSLV 182 RRHAGMQAEVLNMI+ DLF+GHPISQRKLKE+LGHTPSQVLAGAVLGI++ACICCQG LV Sbjct: 124 RRHAGMQAEVLNMIVEDLFKGHPISQRKLKEILGHTPSQVLAGAVLGIVIACICCQGCLV 183 >ref|XP_002876638.1| hypothetical protein ARALYDRAFT_907735 [Arabidopsis lyrata subsp. lyrata] gi|297322476|gb|EFH52897.1| hypothetical protein ARALYDRAFT_907735 [Arabidopsis lyrata subsp. lyrata] Length = 285 Score = 111 bits (277), Expect = 7e-23 Identities = 51/62 (82%), Positives = 58/62 (93%) Frame = +3 Query: 3 RRHAGMQAEVLNMIIADLFQGHPISQRKLKELLGHTPSQVLAGAVLGILVACICCQGSLV 182 RRHAGMQAEVLN+II DLF+GHPISQRKLKELLGHTPSQVLAGA++G+++AC CCQG LV Sbjct: 224 RRHAGMQAEVLNLIIRDLFEGHPISQRKLKELLGHTPSQVLAGALVGVVIACFCCQGYLV 283 Query: 183 PA 188 A Sbjct: 284 SA 285 >emb|CAB71107.1| putative protein [Arabidopsis thaliana] Length = 197 Score = 110 bits (275), Expect = 1e-22 Identities = 51/60 (85%), Positives = 57/60 (95%) Frame = +3 Query: 3 RRHAGMQAEVLNMIIADLFQGHPISQRKLKELLGHTPSQVLAGAVLGILVACICCQGSLV 182 RRHAGMQAEVLN+II DLF+GHPISQRKLKELLGHTPSQVLAGA++GI++AC CCQG LV Sbjct: 136 RRHAGMQAEVLNLIIRDLFEGHPISQRKLKELLGHTPSQVLAGALVGIVIACFCCQGYLV 195