BLASTX nr result
ID: Coptis25_contig00022966
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00022966 (290 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_001771211.1| predicted protein [Physcomitrella patens sub... 120 9e-26 gb|ELR11048.1| alphaCOP, putative [Acanthamoeba castellanii str.... 119 2e-25 ref|XP_001753855.1| predicted protein [Physcomitrella patens sub... 119 2e-25 ref|XP_001766709.1| predicted protein [Physcomitrella patens sub... 119 3e-25 ref|XP_002957821.1| hypothetical protein VOLCADRAFT_77684 [Volvo... 119 3e-25 >ref|XP_001771211.1| predicted protein [Physcomitrella patens subsp. patens] gi|162677452|gb|EDQ63922.1| predicted protein [Physcomitrella patens subsp. patens] Length = 1223 Score = 120 bits (302), Expect = 9e-26 Identities = 52/55 (94%), Positives = 54/55 (98%) Frame = -3 Query: 165 GDDYTIKVWNYKLRRCLFTLLGHLDYIRTVQFHHESPWILSASDDQTIRIWNWQS 1 GDDY IKVWNYK+RRCLFTLLGHLDYIRTVQFHHESPWI+SASDDQTIRIWNWQS Sbjct: 70 GDDYKIKVWNYKMRRCLFTLLGHLDYIRTVQFHHESPWIVSASDDQTIRIWNWQS 124 >gb|ELR11048.1| alphaCOP, putative [Acanthamoeba castellanii str. Neff] Length = 1217 Score = 119 bits (299), Expect = 2e-25 Identities = 52/55 (94%), Positives = 53/55 (96%) Frame = -3 Query: 165 GDDYTIKVWNYKLRRCLFTLLGHLDYIRTVQFHHESPWILSASDDQTIRIWNWQS 1 GDDY IKVWNYKLRRCLFTLLGH+DYIRTVQFHHE PWILSASDDQTIRIWNWQS Sbjct: 70 GDDYKIKVWNYKLRRCLFTLLGHMDYIRTVQFHHEYPWILSASDDQTIRIWNWQS 124 >ref|XP_001753855.1| predicted protein [Physcomitrella patens subsp. patens] gi|162694831|gb|EDQ81177.1| predicted protein [Physcomitrella patens subsp. patens] Length = 1217 Score = 119 bits (299), Expect = 2e-25 Identities = 51/55 (92%), Positives = 54/55 (98%) Frame = -3 Query: 165 GDDYTIKVWNYKLRRCLFTLLGHLDYIRTVQFHHESPWILSASDDQTIRIWNWQS 1 GDDY IKVWNYK+RRCLFTLLGHLDYIRTVQFHHE+PWI+SASDDQTIRIWNWQS Sbjct: 70 GDDYKIKVWNYKMRRCLFTLLGHLDYIRTVQFHHENPWIVSASDDQTIRIWNWQS 124 >ref|XP_001766709.1| predicted protein [Physcomitrella patens subsp. patens] gi|162682141|gb|EDQ68562.1| predicted protein [Physcomitrella patens subsp. patens] Length = 1215 Score = 119 bits (298), Expect = 3e-25 Identities = 51/55 (92%), Positives = 54/55 (98%) Frame = -3 Query: 165 GDDYTIKVWNYKLRRCLFTLLGHLDYIRTVQFHHESPWILSASDDQTIRIWNWQS 1 GDDY IKVWNYK+RRCLFTLLGHLDYIRTV+FHHESPWI+SASDDQTIRIWNWQS Sbjct: 70 GDDYKIKVWNYKMRRCLFTLLGHLDYIRTVKFHHESPWIVSASDDQTIRIWNWQS 124 >ref|XP_002957821.1| hypothetical protein VOLCADRAFT_77684 [Volvox carteri f. nagariensis] gi|300256892|gb|EFJ41149.1| hypothetical protein VOLCADRAFT_77684 [Volvox carteri f. nagariensis] Length = 1224 Score = 119 bits (297), Expect = 3e-25 Identities = 51/55 (92%), Positives = 53/55 (96%) Frame = -3 Query: 165 GDDYTIKVWNYKLRRCLFTLLGHLDYIRTVQFHHESPWILSASDDQTIRIWNWQS 1 GDDY IK+WNYKLRRCLFTLLGHLDYIRTVQFHHE PWI+SASDDQTIRIWNWQS Sbjct: 70 GDDYKIKIWNYKLRRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIWNWQS 124