BLASTX nr result
ID: Coptis25_contig00022963
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00022963 (280 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003580631.1| PREDICTED: nuclease PA3-like [Brachypodium d... 57 2e-06 gb|AAC34856.1| senescence-associated protein 6 [Hemerocallis hyb... 56 3e-06 gb|AFK39715.1| unknown [Lotus japonicus] 56 3e-06 ref|XP_002521424.1| Nuclease PA3, putative [Ricinus communis] gi... 56 3e-06 ref|XP_002317237.1| predicted protein [Populus trichocarpa] gi|2... 55 6e-06 >ref|XP_003580631.1| PREDICTED: nuclease PA3-like [Brachypodium distachyon] Length = 311 Score = 57.0 bits (136), Expect = 2e-06 Identities = 28/38 (73%), Positives = 34/38 (89%) Frame = +3 Query: 3 DKYFSSRMPIVAKRIAQGGVRLAMILNRVFDGDFHEDI 116 D YF+SR+PIVA+RIAQGGVRLAMILNRVF G+ + D+ Sbjct: 262 DDYFASRLPIVARRIAQGGVRLAMILNRVF-GESNRDV 298 >gb|AAC34856.1| senescence-associated protein 6 [Hemerocallis hybrid cultivar] Length = 298 Score = 56.2 bits (134), Expect = 3e-06 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = +3 Query: 3 DKYFSSRMPIVAKRIAQGGVRLAMILNRVF 92 D+YF+SRMPIV KRIAQGGVRLAM+LNRVF Sbjct: 258 DEYFNSRMPIVMKRIAQGGVRLAMVLNRVF 287 >gb|AFK39715.1| unknown [Lotus japonicus] Length = 308 Score = 55.8 bits (133), Expect = 3e-06 Identities = 27/37 (72%), Positives = 31/37 (83%) Frame = +3 Query: 3 DKYFSSRMPIVAKRIAQGGVRLAMILNRVFDGDFHED 113 D+YF SRMP V KRIAQGG+RL MILN+VF GD HE+ Sbjct: 267 DEYFDSRMPFVMKRIAQGGIRLVMILNQVF-GDDHEE 302 >ref|XP_002521424.1| Nuclease PA3, putative [Ricinus communis] gi|223539323|gb|EEF40914.1| Nuclease PA3, putative [Ricinus communis] Length = 286 Score = 55.8 bits (133), Expect = 3e-06 Identities = 28/39 (71%), Positives = 32/39 (82%) Frame = +3 Query: 3 DKYFSSRMPIVAKRIAQGGVRLAMILNRVFDGDFHEDIA 119 D YF+SRMPIV KRIAQGG+RLAM LN++F GD E IA Sbjct: 246 DDYFNSRMPIVMKRIAQGGIRLAMFLNQIF-GDSEEGIA 283 >ref|XP_002317237.1| predicted protein [Populus trichocarpa] gi|222860302|gb|EEE97849.1| predicted protein [Populus trichocarpa] Length = 302 Score = 55.1 bits (131), Expect = 6e-06 Identities = 29/39 (74%), Positives = 30/39 (76%) Frame = +3 Query: 3 DKYFSSRMPIVAKRIAQGGVRLAMILNRVFDGDFHEDIA 119 D YF SRMPIV KRIAQGGVRLAM LNR+F GD E A Sbjct: 262 DDYFDSRMPIVMKRIAQGGVRLAMFLNRIF-GDPEEGFA 299