BLASTX nr result
ID: Coptis25_contig00022922
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00022922 (201 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AEL99257.1| zinc finger family protein, partial [Silene latif... 56 3e-06 >gb|AEL99257.1| zinc finger family protein, partial [Silene latifolia] Length = 166 Score = 56.2 bits (134), Expect = 3e-06 Identities = 24/45 (53%), Positives = 36/45 (80%) Frame = -3 Query: 136 AASTSVEKLRRLKRFSPLDDLFHPISHVICEELFSAIDMEAGHSE 2 A TSVE+LRRL+RF PL+++FHP+++ ICEELFS ++ + +E Sbjct: 36 AGFTSVEQLRRLQRFVPLENVFHPVANAICEELFSVLEQDEKATE 80