BLASTX nr result
ID: Coptis25_contig00022847
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00022847 (326 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABE87589.2| RNA-directed DNA polymerase (Reverse transcriptas... 55 2e-06 >gb|ABE87589.2| RNA-directed DNA polymerase (Reverse transcriptase); Ribonuclease H; Endonuclease/exonuclease/phosphatase [Medicago truncatula] Length = 1246 Score = 54.7 bits (130), Expect(2) = 2e-06 Identities = 32/88 (36%), Positives = 48/88 (54%) Frame = -2 Query: 286 TESEVLRSWGVEGRTAAIQRIKECCWSLPVSPIVKINTDGASFGNPGVASVGAEFRDSLG 107 ++S +L + V R + I W P P++K+NTDG+ G G+A+ G FRDS G Sbjct: 990 SDSAILEEFSVSPRHRKYKDIILVLWKNPSPPLLKVNTDGSVVG--GLAACGGLFRDSSG 1047 Query: 106 IFLLVYCRKIGVTANFVAECTAILEAME 23 FL + IG+ + F AE A + A+E Sbjct: 1048 SFLGAFSCNIGLASVFHAETLAFILALE 1075 Score = 21.9 bits (45), Expect(2) = 2e-06 Identities = 6/9 (66%), Positives = 9/9 (100%) Frame = -3 Query: 27 WKSLWVESD 1 W++LW+ESD Sbjct: 1082 WRNLWLESD 1090