BLASTX nr result
ID: Coptis25_contig00022758
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00022758 (209 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAK82463.1| At1g71830/F14O23_24 [Arabidopsis thaliana] gi|250... 71 8e-11 gb|AAF43236.1|AC012654_20 Contains similarity to the somatic emb... 71 8e-11 ref|NP_177328.1| somatic embryogenesis receptor kinase 1 [Arabid... 71 8e-11 ref|XP_002887392.1| hypothetical protein ARALYDRAFT_895025 [Arab... 71 8e-11 dbj|BAK05837.1| predicted protein [Hordeum vulgare subsp. vulgar... 69 3e-10 >gb|AAK82463.1| At1g71830/F14O23_24 [Arabidopsis thaliana] gi|25090706|gb|AAN72307.1| At1g71830/F14O23_24 [Arabidopsis thaliana] Length = 625 Score = 71.2 bits (173), Expect = 8e-11 Identities = 39/69 (56%), Positives = 45/69 (65%) Frame = +1 Query: 1 ALLCTQGSPMGRPRMSEVVRMXXXXXXXXXXXXXXXQKVELDRQESQLPPNQNDENVFDS 180 ALLCTQGSPM RP+MSEVVRM QKVE+ R+E L PN N + + DS Sbjct: 555 ALLCTQGSPMERPKMSEVVRMLEGDGLAEKWDEW--QKVEILREEIDLSPNPNSDWILDS 612 Query: 181 TFNLHAVEL 207 T+NLHAVEL Sbjct: 613 TYNLHAVEL 621 >gb|AAF43236.1|AC012654_20 Contains similarity to the somatic embryogenesis receptor-like kinase from Daucus carota gb|AC007454; It contains 3 leucine rich repeat domains PF|00560 and a eukaryotic protein kinase domain PF|00069 [Arabidopsis thaliana] Length = 601 Score = 71.2 bits (173), Expect = 8e-11 Identities = 39/69 (56%), Positives = 45/69 (65%) Frame = +1 Query: 1 ALLCTQGSPMGRPRMSEVVRMXXXXXXXXXXXXXXXQKVELDRQESQLPPNQNDENVFDS 180 ALLCTQGSPM RP+MSEVVRM QKVE+ R+E L PN N + + DS Sbjct: 531 ALLCTQGSPMERPKMSEVVRMLEGDGLAEKWDEW--QKVEILREEIDLSPNPNSDWILDS 588 Query: 181 TFNLHAVEL 207 T+NLHAVEL Sbjct: 589 TYNLHAVEL 597 >ref|NP_177328.1| somatic embryogenesis receptor kinase 1 [Arabidopsis thaliana] gi|254814128|sp|Q94AG2.2|SERK1_ARATH RecName: Full=Somatic embryogenesis receptor kinase 1; Short=AtSERK1; AltName: Full=Somatic embryogenesis receptor-like kinase 1; Flags: Precursor gi|224589475|gb|ACN59271.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis thaliana] gi|332197117|gb|AEE35238.1| somatic embryogenesis receptor kinase 1 [Arabidopsis thaliana] Length = 625 Score = 71.2 bits (173), Expect = 8e-11 Identities = 39/69 (56%), Positives = 45/69 (65%) Frame = +1 Query: 1 ALLCTQGSPMGRPRMSEVVRMXXXXXXXXXXXXXXXQKVELDRQESQLPPNQNDENVFDS 180 ALLCTQGSPM RP+MSEVVRM QKVE+ R+E L PN N + + DS Sbjct: 555 ALLCTQGSPMERPKMSEVVRMLEGDGLAEKWDEW--QKVEILREEIDLSPNPNSDWILDS 612 Query: 181 TFNLHAVEL 207 T+NLHAVEL Sbjct: 613 TYNLHAVEL 621 >ref|XP_002887392.1| hypothetical protein ARALYDRAFT_895025 [Arabidopsis lyrata subsp. lyrata] gi|297333233|gb|EFH63651.1| hypothetical protein ARALYDRAFT_895025 [Arabidopsis lyrata subsp. lyrata] Length = 625 Score = 71.2 bits (173), Expect = 8e-11 Identities = 39/69 (56%), Positives = 45/69 (65%) Frame = +1 Query: 1 ALLCTQGSPMGRPRMSEVVRMXXXXXXXXXXXXXXXQKVELDRQESQLPPNQNDENVFDS 180 ALLCTQGSPM RP+MSEVVRM QKVE+ R+E L PN N + + DS Sbjct: 555 ALLCTQGSPMERPKMSEVVRMLEGDGLAERWDEW--QKVEILREEIDLSPNPNSDWILDS 612 Query: 181 TFNLHAVEL 207 T+NLHAVEL Sbjct: 613 TYNLHAVEL 621 >dbj|BAK05837.1| predicted protein [Hordeum vulgare subsp. vulgare] gi|332330747|gb|AEE44134.1| BRI1-associated kinase 1 [Hordeum vulgare subsp. vulgare] Length = 622 Score = 69.3 bits (168), Expect = 3e-10 Identities = 39/69 (56%), Positives = 46/69 (66%) Frame = +1 Query: 1 ALLCTQGSPMGRPRMSEVVRMXXXXXXXXXXXXXXXQKVELDRQESQLPPNQNDENVFDS 180 ALLCTQGSPM RP+MSEVVRM QKVE+ RQE +L P++N E + DS Sbjct: 552 ALLCTQGSPMERPKMSEVVRM--LEGDGLAERWDEWQKVEVSRQEVELGPHRNSEWIVDS 609 Query: 181 TFNLHAVEL 207 T +LHAVEL Sbjct: 610 TDSLHAVEL 618