BLASTX nr result
ID: Coptis25_contig00022678
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00022678 (707 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002529385.1| Cyclic nucleotide-gated ion channel, putativ... 58 2e-06 >ref|XP_002529385.1| Cyclic nucleotide-gated ion channel, putative [Ricinus communis] gi|223531133|gb|EEF32981.1| Cyclic nucleotide-gated ion channel, putative [Ricinus communis] Length = 735 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/63 (42%), Positives = 39/63 (61%) Frame = -3 Query: 636 FFFFHLYIDPTNYLDFNNNLEIITSTVRIIDDAFYVIRTICQFHIYYVASAYEVFSEGEL 457 FF+ ++ DP + L + L II +T+R + DAFY+IR QF Y+A + VF GEL Sbjct: 129 FFYLPVFNDPAHCLGIDRKLAIIATTLRTVIDAFYLIRMALQFRTAYIAPSSRVFGRGEL 188 Query: 456 VMD 448 V+D Sbjct: 189 VID 191