BLASTX nr result
ID: Coptis25_contig00022502
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00022502 (456 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002269977.2| PREDICTED: histidine kinase 2-like [Vitis vi... 66 3e-09 >ref|XP_002269977.2| PREDICTED: histidine kinase 2-like [Vitis vinifera] Length = 1272 Score = 66.2 bits (160), Expect = 3e-09 Identities = 47/110 (42%), Positives = 62/110 (56%), Gaps = 8/110 (7%) Frame = -1 Query: 306 MSIVSIAGVILKLPRLLLRICRWVLVKMALNGKLPSPKNRSSWWLK----KEKVQGF--- 148 MS ++AGV LKL RL+L+ICRWVL+KM+LN KL R LK KE + G Sbjct: 1 MSFSAVAGVFLKLSRLILKICRWVLLKMSLNCKLSGFSGRLPANLKLKKSKEPLHGSNCV 60 Query: 147 -KWRSRAYLILWVFLVSCVVGFLLFSPNGNGVSGIKHRGTELWWEEKARI 1 KWR R +L+LW L+ ++G + F N + + T EEKARI Sbjct: 61 RKWR-RKFLLLW--LLGVIIGLICFLSVLNAGALSRKEKTPDLCEEKARI 107