BLASTX nr result
ID: Coptis25_contig00022474
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00022474 (357 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI19755.3| unnamed protein product [Vitis vinifera] 55 8e-06 >emb|CBI19755.3| unnamed protein product [Vitis vinifera] Length = 463 Score = 54.7 bits (130), Expect = 8e-06 Identities = 26/57 (45%), Positives = 39/57 (68%) Frame = +1 Query: 187 MAKHSVGWITFQKRYLLMLLVIFSVSTAIVFVIRAAFDTCDRHYESGASNNRVKITT 357 MAK S W+TF KR+ L+L+ + S ST IV +IRAA D+C+ + SN R+++T+ Sbjct: 1 MAKQSTSWLTFHKRWPLLLVALLSTSTVIVLLIRAASDSCNTN-----SNTRIQVTS 52