BLASTX nr result
ID: Coptis25_contig00022147
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00022147 (468 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI33278.3| unnamed protein product [Vitis vinifera] 64 1e-08 ref|XP_002465363.1| hypothetical protein SORBIDRAFT_01g037210 [S... 63 2e-08 ref|XP_003597448.1| AP2-like ethylene-responsive transcription f... 62 4e-08 dbj|BAF81518.1| AP2/EREBP transcription factor [Brassica rapa] 62 6e-08 gb|AFU81582.1| AP2-EREBP-type transcription factor, partial [Zea... 61 8e-08 >emb|CBI33278.3| unnamed protein product [Vitis vinifera] Length = 635 Score = 64.3 bits (155), Expect = 1e-08 Identities = 27/39 (69%), Positives = 32/39 (82%) Frame = +1 Query: 199 TLENSVCRHRWIGRYEAHLWDNTRRREGQSRKERQGISL 315 ++ V RHRW GRYEAHLWDN+ RREGQ+RK RQG+SL Sbjct: 234 SIYRGVTRHRWTGRYEAHLWDNSSRREGQARKGRQGLSL 272 >ref|XP_002465363.1| hypothetical protein SORBIDRAFT_01g037210 [Sorghum bicolor] gi|241919217|gb|EER92361.1| hypothetical protein SORBIDRAFT_01g037210 [Sorghum bicolor] Length = 424 Score = 63.2 bits (152), Expect = 2e-08 Identities = 27/42 (64%), Positives = 32/42 (76%) Frame = +1 Query: 181 TTTAQETLENSVCRHRWIGRYEAHLWDNTRRREGQSRKERQG 306 TT+ + ++ V RHRW GRYEAHLWDNT R+EGQ RK RQG Sbjct: 138 TTSHRTSIYRGVTRHRWTGRYEAHLWDNTCRKEGQKRKGRQG 179 >ref|XP_003597448.1| AP2-like ethylene-responsive transcription factor BBM [Medicago truncatula] gi|355486496|gb|AES67699.1| AP2-like ethylene-responsive transcription factor BBM [Medicago truncatula] Length = 522 Score = 62.4 bits (150), Expect = 4e-08 Identities = 27/36 (75%), Positives = 29/36 (80%) Frame = +1 Query: 199 TLENSVCRHRWIGRYEAHLWDNTRRREGQSRKERQG 306 ++ V RHRW GRYEAHLWDNT RREGQSRK RQG Sbjct: 169 SIYRGVTRHRWTGRYEAHLWDNTCRREGQSRKGRQG 204 >dbj|BAF81518.1| AP2/EREBP transcription factor [Brassica rapa] Length = 323 Score = 61.6 bits (148), Expect = 6e-08 Identities = 28/47 (59%), Positives = 33/47 (70%) Frame = +1 Query: 199 TLENSVCRHRWIGRYEAHLWDNTRRREGQSRKERQGISL*ASYHCLF 339 ++ V RHRW GRYEAHLWDN+ RREGQ+RK RQGI + C F Sbjct: 268 SIYRGVTRHRWTGRYEAHLWDNSCRREGQARKGRQGI-----FFCFF 309 >gb|AFU81582.1| AP2-EREBP-type transcription factor, partial [Zea mays subsp. mays] gi|414865110|tpg|DAA43667.1| TPA: putative AP2/EREBP transcription factor superfamily protein isoform 1 [Zea mays] gi|414865111|tpg|DAA43668.1| TPA: putative AP2/EREBP transcription factor superfamily protein isoform 2 [Zea mays] gi|414865112|tpg|DAA43669.1| TPA: putative AP2/EREBP transcription factor superfamily protein isoform 3 [Zea mays] gi|414865113|tpg|DAA43670.1| TPA: putative AP2/EREBP transcription factor superfamily protein isoform 4 [Zea mays] Length = 310 Score = 61.2 bits (147), Expect = 8e-08 Identities = 29/44 (65%), Positives = 32/44 (72%), Gaps = 1/44 (2%) Frame = +1 Query: 184 TTAQETLE-NSVCRHRWIGRYEAHLWDNTRRREGQSRKERQGIS 312 T Q T + V RHRW GRYEAHLWDNT R+EGQ+RK RQG S Sbjct: 264 TFGQRTSQFRGVTRHRWTGRYEAHLWDNTCRKEGQTRKGRQGCS 307