BLASTX nr result
ID: Coptis25_contig00022110
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00022110 (254 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002314304.1| predicted protein [Populus trichocarpa] gi|2... 77 1e-12 ref|XP_002523718.1| zinc finger protein, putative [Ricinus commu... 76 3e-12 ref|XP_002268193.1| PREDICTED: RING finger and CHY zinc finger d... 75 4e-12 ref|XP_004166307.1| PREDICTED: RING finger and CHY zinc finger d... 74 1e-11 ref|XP_004145767.1| PREDICTED: RING finger and CHY zinc finger d... 74 1e-11 >ref|XP_002314304.1| predicted protein [Populus trichocarpa] gi|222850712|gb|EEE88259.1| predicted protein [Populus trichocarpa] Length = 291 Score = 77.4 bits (189), Expect = 1e-12 Identities = 32/52 (61%), Positives = 43/52 (82%) Frame = +2 Query: 2 NCPVCFEYLFDSMKDISVLQCGHTIHLDCLKEMEMHFK*VFFYNCQMNSNAL 157 NCPVCFE+LFD+M+DI+VL CGHTIHL+CLKEME H++ Y+C + S ++ Sbjct: 166 NCPVCFEFLFDTMRDITVLPCGHTIHLECLKEMEQHYR----YSCPVCSKSI 213 >ref|XP_002523718.1| zinc finger protein, putative [Ricinus communis] gi|223537022|gb|EEF38658.1| zinc finger protein, putative [Ricinus communis] Length = 275 Score = 76.3 bits (186), Expect = 3e-12 Identities = 31/52 (59%), Positives = 43/52 (82%) Frame = +2 Query: 2 NCPVCFEYLFDSMKDISVLQCGHTIHLDCLKEMEMHFK*VFFYNCQMNSNAL 157 NCPVCFE+LFD+MKDI+VL CGHTIHL+C++EME H++ Y+C + S ++ Sbjct: 150 NCPVCFEFLFDTMKDITVLPCGHTIHLECVREMEQHYR----YSCPVCSKSI 197 >ref|XP_002268193.1| PREDICTED: RING finger and CHY zinc finger domain-containing protein 1 isoform 2 [Vitis vinifera] gi|225441159|ref|XP_002268149.1| PREDICTED: RING finger and CHY zinc finger domain-containing protein 1 isoform 1 [Vitis vinifera] gi|297739980|emb|CBI30162.3| unnamed protein product [Vitis vinifera] Length = 289 Score = 75.5 bits (184), Expect = 4e-12 Identities = 33/51 (64%), Positives = 40/51 (78%) Frame = +2 Query: 2 NCPVCFEYLFDSMKDISVLQCGHTIHLDCLKEMEMHFK*VFFYNCQMNSNA 154 NCPVCFEYLFD+ DI+VL CGHTIHL+CLKEME HF+ Y+C + S + Sbjct: 165 NCPVCFEYLFDTTTDITVLHCGHTIHLECLKEMERHFQ----YSCPVCSKS 211 >ref|XP_004166307.1| PREDICTED: RING finger and CHY zinc finger domain-containing protein 1-like [Cucumis sativus] Length = 303 Score = 73.9 bits (180), Expect = 1e-11 Identities = 32/52 (61%), Positives = 41/52 (78%) Frame = +2 Query: 2 NCPVCFEYLFDSMKDISVLQCGHTIHLDCLKEMEMHFK*VFFYNCQMNSNAL 157 +CPVCFE+LFD+ KDISVL CGHTIHL+C KEME HF+ Y+C + S ++ Sbjct: 176 SCPVCFEFLFDTTKDISVLPCGHTIHLECAKEMESHFQ----YSCPVCSKSI 223 >ref|XP_004145767.1| PREDICTED: RING finger and CHY zinc finger domain-containing protein 1-like [Cucumis sativus] Length = 303 Score = 73.9 bits (180), Expect = 1e-11 Identities = 32/52 (61%), Positives = 41/52 (78%) Frame = +2 Query: 2 NCPVCFEYLFDSMKDISVLQCGHTIHLDCLKEMEMHFK*VFFYNCQMNSNAL 157 +CPVCFE+LFD+ KDISVL CGHTIHL+C KEME HF+ Y+C + S ++ Sbjct: 176 SCPVCFEFLFDTTKDISVLPCGHTIHLECAKEMESHFQ----YSCPVCSKSI 223