BLASTX nr result
ID: Coptis25_contig00022056
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00022056 (244 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003574205.1| PREDICTED: DNA excision repair protein ERCC-... 70 2e-10 ref|NP_187172.1| DNA excision repair protein ERCC-1 [Arabidopsis... 69 3e-10 ref|XP_002281063.2| PREDICTED: DNA excision repair protein ERCC-... 69 3e-10 ref|XP_002512344.1| excision repair cross-complementing 1 ercc1,... 69 3e-10 ref|XP_002328427.1| predicted protein [Populus trichocarpa] gi|2... 69 3e-10 >ref|XP_003574205.1| PREDICTED: DNA excision repair protein ERCC-1-like [Brachypodium distachyon] Length = 391 Score = 70.1 bits (170), Expect = 2e-10 Identities = 30/34 (88%), Positives = 34/34 (100%) Frame = +1 Query: 88 RIMDSSMEDLARCPGIGEKKVKRLYDTFHEPFRR 189 RIMDSSME+LARCPGIGE+KVKR+YDTFHEPF+R Sbjct: 266 RIMDSSMEELARCPGIGERKVKRIYDTFHEPFKR 299 >ref|NP_187172.1| DNA excision repair protein ERCC-1 [Arabidopsis thaliana] gi|55976606|sp|Q9MA98.1|ERCC1_ARATH RecName: Full=DNA excision repair protein ERCC-1; Short=AtERCC1; Short=AtRAD10; AltName: Full=Ultraviolet hypersensitive 7 gi|6729031|gb|AAF27027.1|AC009177_17 putative nucleotide repair protein [Arabidopsis thaliana] gi|9800490|gb|AAF99316.1|AF276082_1 ERCC1 [Arabidopsis thaliana] gi|15215614|gb|AAK91352.1| AT3g05210/T12H1_18 [Arabidopsis thaliana] gi|21435979|gb|AAM51569.1| AT3g05210/T12H1_18 [Arabidopsis thaliana] gi|21618171|gb|AAM67221.1| putative nucleotide repair protein [Arabidopsis thaliana] gi|332640684|gb|AEE74205.1| DNA excision repair protein ERCC-1 [Arabidopsis thaliana] Length = 410 Score = 69.3 bits (168), Expect = 3e-10 Identities = 30/34 (88%), Positives = 34/34 (100%) Frame = +1 Query: 91 IMDSSMEDLARCPGIGEKKVKRLYDTFHEPFRRA 192 I+D+SMEDLARCPGIGE+KVKRLYDTFHEPF+RA Sbjct: 288 IIDASMEDLARCPGIGERKVKRLYDTFHEPFKRA 321 Score = 55.8 bits (133), Expect = 3e-06 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +2 Query: 2 EDVVKPILEVTKTALLHDCTLLCAWS 79 ED VKP+LEVTKTALLHDCTLLCAWS Sbjct: 201 EDTVKPLLEVTKTALLHDCTLLCAWS 226 >ref|XP_002281063.2| PREDICTED: DNA excision repair protein ERCC-1-like [Vitis vinifera] gi|296088298|emb|CBI36743.3| unnamed protein product [Vitis vinifera] Length = 398 Score = 69.3 bits (168), Expect = 3e-10 Identities = 30/33 (90%), Positives = 33/33 (100%) Frame = +1 Query: 91 IMDSSMEDLARCPGIGEKKVKRLYDTFHEPFRR 189 IMD+SMEDLARCPGIGE+KVKRLYDTFHEPF+R Sbjct: 270 IMDASMEDLARCPGIGERKVKRLYDTFHEPFKR 302 Score = 55.8 bits (133), Expect = 3e-06 Identities = 23/26 (88%), Positives = 26/26 (100%) Frame = +2 Query: 2 EDVVKPILEVTKTALLHDCTLLCAWS 79 EDV+KP+LEVT+TALLHDCTLLCAWS Sbjct: 183 EDVIKPLLEVTRTALLHDCTLLCAWS 208 >ref|XP_002512344.1| excision repair cross-complementing 1 ercc1, putative [Ricinus communis] gi|223548305|gb|EEF49796.1| excision repair cross-complementing 1 ercc1, putative [Ricinus communis] Length = 392 Score = 69.3 bits (168), Expect = 3e-10 Identities = 30/33 (90%), Positives = 33/33 (100%) Frame = +1 Query: 91 IMDSSMEDLARCPGIGEKKVKRLYDTFHEPFRR 189 IMD+SMEDLARCPGIGE+KVKRLYDTFHEPF+R Sbjct: 265 IMDASMEDLARCPGIGERKVKRLYDTFHEPFKR 297 Score = 57.4 bits (137), Expect = 1e-06 Identities = 25/26 (96%), Positives = 26/26 (100%) Frame = +2 Query: 2 EDVVKPILEVTKTALLHDCTLLCAWS 79 EDVVKP+LEVTKTALLHDCTLLCAWS Sbjct: 178 EDVVKPLLEVTKTALLHDCTLLCAWS 203 >ref|XP_002328427.1| predicted protein [Populus trichocarpa] gi|222838142|gb|EEE76507.1| predicted protein [Populus trichocarpa] Length = 382 Score = 69.3 bits (168), Expect = 3e-10 Identities = 30/33 (90%), Positives = 33/33 (100%) Frame = +1 Query: 91 IMDSSMEDLARCPGIGEKKVKRLYDTFHEPFRR 189 IMD+SMEDLARCPGIGE+KVKRLYDTFHEPF+R Sbjct: 259 IMDASMEDLARCPGIGERKVKRLYDTFHEPFKR 291 Score = 57.4 bits (137), Expect = 1e-06 Identities = 25/26 (96%), Positives = 26/26 (100%) Frame = +2 Query: 2 EDVVKPILEVTKTALLHDCTLLCAWS 79 EDVVKP+LEVTKTALLHDCTLLCAWS Sbjct: 172 EDVVKPLLEVTKTALLHDCTLLCAWS 197