BLASTX nr result
ID: Coptis25_contig00022055
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00022055 (315 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI31022.3| unnamed protein product [Vitis vinifera] 100 2e-19 ref|XP_002264075.1| PREDICTED: WPP domain-associated protein-lik... 100 2e-19 ref|XP_004158693.1| PREDICTED: WPP domain-associated protein-lik... 90 2e-16 ref|XP_004134899.1| PREDICTED: WPP domain-associated protein-lik... 90 2e-16 ref|XP_002523187.1| Early endosome antigen, putative [Ricinus co... 86 3e-15 >emb|CBI31022.3| unnamed protein product [Vitis vinifera] Length = 807 Score = 100 bits (248), Expect = 2e-19 Identities = 54/105 (51%), Positives = 68/105 (64%) Frame = +1 Query: 1 ARESGQKKQVELLSTYVERLFKTAADFEGQTMEIVEXXXXXXXXXXXXXYPLVQNPALSR 180 ARE KQ+E + ++ L K A+FEG+ + ++ PL+Q + R Sbjct: 671 AREREHSKQMESIIVFMNGLSKVMAEFEGRVEKDIKRNSFRLEHANSQLTPLIQKANILR 730 Query: 181 KSELVYKERLERRYSDLQKAEAEVDLLGDEVDALLSLLEKIYIGL 315 ++ L YK+RLERRYSDLQKAE EVDLLGDEVDALLSLLEKIYI L Sbjct: 731 RTSLRYKQRLERRYSDLQKAETEVDLLGDEVDALLSLLEKIYIAL 775 >ref|XP_002264075.1| PREDICTED: WPP domain-associated protein-like [Vitis vinifera] Length = 902 Score = 100 bits (248), Expect = 2e-19 Identities = 54/105 (51%), Positives = 68/105 (64%) Frame = +1 Query: 1 ARESGQKKQVELLSTYVERLFKTAADFEGQTMEIVEXXXXXXXXXXXXXYPLVQNPALSR 180 ARE KQ+E + ++ L K A+FEG+ + ++ PL+Q + R Sbjct: 766 AREREHSKQMESIIVFMNGLSKVMAEFEGRVEKDIKRNSFRLEHANSQLTPLIQKANILR 825 Query: 181 KSELVYKERLERRYSDLQKAEAEVDLLGDEVDALLSLLEKIYIGL 315 ++ L YK+RLERRYSDLQKAE EVDLLGDEVDALLSLLEKIYI L Sbjct: 826 RTSLRYKQRLERRYSDLQKAETEVDLLGDEVDALLSLLEKIYIAL 870 >ref|XP_004158693.1| PREDICTED: WPP domain-associated protein-like [Cucumis sativus] Length = 852 Score = 90.1 bits (222), Expect = 2e-16 Identities = 47/104 (45%), Positives = 67/104 (64%) Frame = +1 Query: 4 RESGQKKQVELLSTYVERLFKTAADFEGQTMEIVEXXXXXXXXXXXXXYPLVQNPALSRK 183 +E +KQ+E++ V+ L K DFE + ++ + L+Q+ ++ ++ Sbjct: 717 KEKEYRKQMEMVIFVVQELSKEVFDFEHRVIDYISRNNERLESLSFETKSLIQDASMVKR 776 Query: 184 SELVYKERLERRYSDLQKAEAEVDLLGDEVDALLSLLEKIYIGL 315 L+YK+RLE+R SDLQKAEAEVDLLGDEVDALL LLEK+YI L Sbjct: 777 DGLIYKQRLEKRCSDLQKAEAEVDLLGDEVDALLRLLEKMYIAL 820 >ref|XP_004134899.1| PREDICTED: WPP domain-associated protein-like [Cucumis sativus] Length = 881 Score = 90.1 bits (222), Expect = 2e-16 Identities = 47/104 (45%), Positives = 67/104 (64%) Frame = +1 Query: 4 RESGQKKQVELLSTYVERLFKTAADFEGQTMEIVEXXXXXXXXXXXXXYPLVQNPALSRK 183 +E +KQ+E++ V+ L K DFE + ++ + L+Q+ ++ ++ Sbjct: 746 KEKEYRKQMEMVIFVVQELSKEVFDFEHRVIDYISRNNERLESLSFETKSLIQDASMVKR 805 Query: 184 SELVYKERLERRYSDLQKAEAEVDLLGDEVDALLSLLEKIYIGL 315 L+YK+RLE+R SDLQKAEAEVDLLGDEVDALL LLEK+YI L Sbjct: 806 DGLIYKQRLEKRCSDLQKAEAEVDLLGDEVDALLRLLEKMYIAL 849 >ref|XP_002523187.1| Early endosome antigen, putative [Ricinus communis] gi|223537594|gb|EEF39218.1| Early endosome antigen, putative [Ricinus communis] Length = 903 Score = 85.9 bits (211), Expect = 3e-15 Identities = 51/105 (48%), Positives = 63/105 (60%) Frame = +1 Query: 1 ARESGQKKQVELLSTYVERLFKTAADFEGQTMEIVEXXXXXXXXXXXXXYPLVQNPALSR 180 ARE +KQ+ V+ L K DFE +T E + LVQ+ R Sbjct: 767 AREIEYRKQINSTIILVQELSKAVTDFECRTTEDLRVNSLRLEHLSSQLSSLVQDANKLR 826 Query: 181 KSELVYKERLERRYSDLQKAEAEVDLLGDEVDALLSLLEKIYIGL 315 ++ L+YK++LE R SDL+KAEAEVDLLGDEVD LLSLLEKIYI L Sbjct: 827 RTGLMYKQKLEVRCSDLRKAEAEVDLLGDEVDTLLSLLEKIYIAL 871