BLASTX nr result
ID: Coptis25_contig00021911
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00021911 (445 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002268521.1| PREDICTED: uncharacterized protein LOC100256... 61 8e-08 ref|XP_002297772.1| predicted protein [Populus trichocarpa] gi|2... 59 3e-07 ref|XP_002513115.1| conserved hypothetical protein [Ricinus comm... 59 4e-07 >ref|XP_002268521.1| PREDICTED: uncharacterized protein LOC100256905 [Vitis vinifera] Length = 133 Score = 61.2 bits (147), Expect = 8e-08 Identities = 32/54 (59%), Positives = 40/54 (74%) Frame = +1 Query: 280 RYSWNDKEKKNRGFVVVTRAGPPSNTSLIFAFVFPLTLLLATIFTSIRIADKLD 441 R+S +K RG VVTRAGP S +S +FAFVFPL+LL TIFTS+R+ DKL+ Sbjct: 37 RFSGELCRRKTRGLSVVTRAGP-STSSYVFAFVFPLSLLAVTIFTSLRVDDKLE 89 >ref|XP_002297772.1| predicted protein [Populus trichocarpa] gi|222845030|gb|EEE82577.1| predicted protein [Populus trichocarpa] Length = 162 Score = 59.3 bits (142), Expect = 3e-07 Identities = 33/55 (60%), Positives = 40/55 (72%) Frame = +1 Query: 280 RYSWNDKEKKNRGFVVVTRAGPPSNTSLIFAFVFPLTLLLATIFTSIRIADKLDE 444 R S + +K RG VVTRAG +N S + AF+ PL+LL ATIFTSIRIADKLD+ Sbjct: 32 RISDDPWRRKKRGLTVVTRAGLSAN-SYVLAFLLPLSLLAATIFTSIRIADKLDQ 85 >ref|XP_002513115.1| conserved hypothetical protein [Ricinus communis] gi|223548126|gb|EEF49618.1| conserved hypothetical protein [Ricinus communis] Length = 93 Score = 58.9 bits (141), Expect = 4e-07 Identities = 30/46 (65%), Positives = 36/46 (78%) Frame = +1 Query: 304 KKNRGFVVVTRAGPPSNTSLIFAFVFPLTLLLATIFTSIRIADKLD 441 K RG ++ RAGP S +S +FAFVFPL+LL+ TI TSIRIADKLD Sbjct: 40 KTRRGSALIPRAGP-STSSYVFAFVFPLSLLIGTIITSIRIADKLD 84