BLASTX nr result
ID: Coptis25_contig00021848
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00021848 (504 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN78447.1| hypothetical protein VITISV_026810 [Vitis vinifera] 54 1e-05 >emb|CAN78447.1| hypothetical protein VITISV_026810 [Vitis vinifera] Length = 1171 Score = 54.3 bits (129), Expect = 1e-05 Identities = 25/46 (54%), Positives = 32/46 (69%), Gaps = 1/46 (2%) Frame = -2 Query: 152 SSRPQCQICNKFGHIALDCHNRMNHSYVGRIPPTKL-AMLASFNDT 18 ++RP CQIC K GH A+DC +R ++SY GR PP L AM+A N T Sbjct: 270 NNRPVCQICGKSGHTAIDCFHRFDYSYQGRFPPQDLAAMVAETNAT 315