BLASTX nr result
ID: Coptis25_contig00021662
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00021662 (321 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI24213.3| unnamed protein product [Vitis vinifera] 56 3e-06 ref|XP_002275100.1| PREDICTED: chromodomain-helicase-DNA-binding... 56 3e-06 >emb|CBI24213.3| unnamed protein product [Vitis vinifera] Length = 1539 Score = 56.2 bits (134), Expect = 3e-06 Identities = 24/31 (77%), Positives = 29/31 (93%) Frame = -1 Query: 93 ALLHFLESEKFKNKEDFVERYKNLSSFNELE 1 ALLHFL+ +KFKNK+DFV+ YKNLSSFNE+E Sbjct: 597 ALLHFLDPDKFKNKDDFVQNYKNLSSFNEME 627 >ref|XP_002275100.1| PREDICTED: chromodomain-helicase-DNA-binding protein 2-like [Vitis vinifera] Length = 1764 Score = 56.2 bits (134), Expect = 3e-06 Identities = 24/31 (77%), Positives = 29/31 (93%) Frame = -1 Query: 93 ALLHFLESEKFKNKEDFVERYKNLSSFNELE 1 ALLHFL+ +KFKNK+DFV+ YKNLSSFNE+E Sbjct: 794 ALLHFLDPDKFKNKDDFVQNYKNLSSFNEME 824