BLASTX nr result
ID: Coptis25_contig00021641
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00021641 (446 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAD28668.1| putative chromodomain-helicase-DNA-binding protei... 82 1e-25 ref|NP_178970.3| chromatin remodeling 5 [Arabidopsis thaliana] g... 82 1e-25 ref|XP_002885872.1| hypothetical protein ARALYDRAFT_480306 [Arab... 82 1e-25 dbj|BAD94038.1| pseudogene [Arabidopsis thaliana] 82 1e-25 ref|XP_002531123.1| chromodomain helicase DNA binding protein, p... 81 2e-25 >gb|AAD28668.1| putative chromodomain-helicase-DNA-binding protein [Arabidopsis thaliana] Length = 1738 Score = 82.0 bits (201), Expect(2) = 1e-25 Identities = 43/53 (81%), Positives = 43/53 (81%) Frame = -2 Query: 328 YTILKSIMLSSLLNLHTELRPHILRRVIKDVEKSLPPKIERILRVVMSPLQKQ 170 Y L S S L NLH ELRPHILRRVIKDVEKSLPPKIERILRV MSPLQKQ Sbjct: 835 YKNLSSFNESELANLHLELRPHILRRVIKDVEKSLPPKIERILRVEMSPLQKQ 887 Score = 59.7 bits (143), Expect(2) = 1e-25 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = -1 Query: 86 RYYKWILERNFHDLNKGVHGNQVSLLNI 3 +YYKWILERNFHDLNKGV GNQVSLLNI Sbjct: 887 QYYKWILERNFHDLNKGVRGNQVSLLNI 914 >ref|NP_178970.3| chromatin remodeling 5 [Arabidopsis thaliana] gi|330251136|gb|AEC06230.1| chromatin remodeling 5 [Arabidopsis thaliana] Length = 1724 Score = 82.0 bits (201), Expect(2) = 1e-25 Identities = 43/53 (81%), Positives = 43/53 (81%) Frame = -2 Query: 328 YTILKSIMLSSLLNLHTELRPHILRRVIKDVEKSLPPKIERILRVVMSPLQKQ 170 Y L S S L NLH ELRPHILRRVIKDVEKSLPPKIERILRV MSPLQKQ Sbjct: 821 YKNLSSFNESELANLHLELRPHILRRVIKDVEKSLPPKIERILRVEMSPLQKQ 873 Score = 59.7 bits (143), Expect(2) = 1e-25 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = -1 Query: 86 RYYKWILERNFHDLNKGVHGNQVSLLNI 3 +YYKWILERNFHDLNKGV GNQVSLLNI Sbjct: 873 QYYKWILERNFHDLNKGVRGNQVSLLNI 900 >ref|XP_002885872.1| hypothetical protein ARALYDRAFT_480306 [Arabidopsis lyrata subsp. lyrata] gi|297331712|gb|EFH62131.1| hypothetical protein ARALYDRAFT_480306 [Arabidopsis lyrata subsp. lyrata] Length = 1721 Score = 82.0 bits (201), Expect(2) = 1e-25 Identities = 43/53 (81%), Positives = 43/53 (81%) Frame = -2 Query: 328 YTILKSIMLSSLLNLHTELRPHILRRVIKDVEKSLPPKIERILRVVMSPLQKQ 170 Y L S S L NLH ELRPHILRRVIKDVEKSLPPKIERILRV MSPLQKQ Sbjct: 818 YKNLSSFNESELANLHLELRPHILRRVIKDVEKSLPPKIERILRVEMSPLQKQ 870 Score = 59.7 bits (143), Expect(2) = 1e-25 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = -1 Query: 86 RYYKWILERNFHDLNKGVHGNQVSLLNI 3 +YYKWILERNFHDLNKGV GNQVSLLNI Sbjct: 870 QYYKWILERNFHDLNKGVRGNQVSLLNI 897 >dbj|BAD94038.1| pseudogene [Arabidopsis thaliana] Length = 1221 Score = 82.0 bits (201), Expect(2) = 1e-25 Identities = 43/53 (81%), Positives = 43/53 (81%) Frame = -2 Query: 328 YTILKSIMLSSLLNLHTELRPHILRRVIKDVEKSLPPKIERILRVVMSPLQKQ 170 Y L S S L NLH ELRPHILRRVIKDVEKSLPPKIERILRV MSPLQKQ Sbjct: 821 YKNLNSFNESELANLHLELRPHILRRVIKDVEKSLPPKIERILRVEMSPLQKQ 873 Score = 59.7 bits (143), Expect(2) = 1e-25 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = -1 Query: 86 RYYKWILERNFHDLNKGVHGNQVSLLNI 3 +YYKWILERNFHDLNKGV GNQVSLLNI Sbjct: 873 QYYKWILERNFHDLNKGVRGNQVSLLNI 900 >ref|XP_002531123.1| chromodomain helicase DNA binding protein, putative [Ricinus communis] gi|223529287|gb|EEF31257.1| chromodomain helicase DNA binding protein, putative [Ricinus communis] Length = 1718 Score = 81.3 bits (199), Expect(2) = 2e-25 Identities = 41/44 (93%), Positives = 41/44 (93%) Frame = -2 Query: 301 SSLLNLHTELRPHILRRVIKDVEKSLPPKIERILRVVMSPLQKQ 170 SSL NLH ELRPHILRRVIKDVEKSLPPKIERILRV MSPLQKQ Sbjct: 791 SSLANLHMELRPHILRRVIKDVEKSLPPKIERILRVEMSPLQKQ 834 Score = 59.7 bits (143), Expect(2) = 2e-25 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = -1 Query: 86 RYYKWILERNFHDLNKGVHGNQVSLLNI 3 +YYKWILERNFHDLNKGV GNQVSLLNI Sbjct: 834 QYYKWILERNFHDLNKGVRGNQVSLLNI 861