BLASTX nr result
ID: Coptis25_contig00021618
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00021618 (224 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EGG11110.1| hypothetical protein MELLADRAFT_70923 [Melampsora... 55 6e-06 >gb|EGG11110.1| hypothetical protein MELLADRAFT_70923 [Melampsora larici-populina 98AG31] Length = 438 Score = 55.1 bits (131), Expect = 6e-06 Identities = 24/33 (72%), Positives = 29/33 (87%) Frame = +3 Query: 126 MSVMIETSLGSIVIDLEPKLCPITTKNFLKLCK 224 MSV+ ETSLG +V+DLE LCPIT++NFLKLCK Sbjct: 1 MSVLFETSLGDLVVDLETDLCPITSENFLKLCK 33