BLASTX nr result
ID: Coptis25_contig00021516
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00021516 (273 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002531516.1| dfg10 protein, putative [Ricinus communis] g... 60 1e-07 emb|CBI37979.3| unnamed protein product [Vitis vinifera] 60 2e-07 ref|XP_002269318.1| PREDICTED: probable polyprenol reductase 2-l... 60 2e-07 ref|XP_002513007.1| dfg10 protein, putative [Ricinus communis] g... 59 4e-07 ref|XP_002313005.1| predicted protein [Populus trichocarpa] gi|2... 58 9e-07 >ref|XP_002531516.1| dfg10 protein, putative [Ricinus communis] gi|223528869|gb|EEF30870.1| dfg10 protein, putative [Ricinus communis] Length = 342 Score = 60.5 bits (145), Expect = 1e-07 Identities = 28/45 (62%), Positives = 35/45 (77%) Frame = +2 Query: 137 MELEIDKLLRAAWIAGIFPILLASLPITRIASFHRILSGFSNRGK 271 ME+ +D LLR AWIAG PILLASLP + + SFH++L GF+ RGK Sbjct: 1 MEIHLDWLLRLAWIAGTLPILLASLPSSSLNSFHQLLLGFAKRGK 45 >emb|CBI37979.3| unnamed protein product [Vitis vinifera] Length = 355 Score = 59.7 bits (143), Expect = 2e-07 Identities = 27/45 (60%), Positives = 36/45 (80%) Frame = +2 Query: 137 MELEIDKLLRAAWIAGIFPILLASLPITRIASFHRILSGFSNRGK 271 MEL++ LLRAAWIAG PIL+AS+P +R+ SFH ++ GF+ RGK Sbjct: 1 MELDLVALLRAAWIAGTLPILIASIPSSRLHSFHGLVLGFARRGK 45 >ref|XP_002269318.1| PREDICTED: probable polyprenol reductase 2-like [Vitis vinifera] Length = 338 Score = 59.7 bits (143), Expect = 2e-07 Identities = 27/45 (60%), Positives = 36/45 (80%) Frame = +2 Query: 137 MELEIDKLLRAAWIAGIFPILLASLPITRIASFHRILSGFSNRGK 271 MEL++ LLRAAWIAG PIL+AS+P +R+ SFH ++ GF+ RGK Sbjct: 1 MELDLVALLRAAWIAGTLPILIASIPSSRLHSFHGLVLGFARRGK 45 >ref|XP_002513007.1| dfg10 protein, putative [Ricinus communis] gi|223548018|gb|EEF49510.1| dfg10 protein, putative [Ricinus communis] Length = 339 Score = 58.9 bits (141), Expect = 4e-07 Identities = 26/45 (57%), Positives = 33/45 (73%) Frame = +2 Query: 137 MELEIDKLLRAAWIAGIFPILLASLPITRIASFHRILSGFSNRGK 271 ME + LR AWIAGI PI++ASLP ++ SFHR++ GFS RGK Sbjct: 1 MEFGLVGFLRVAWIAGILPIVIASLPFPKLGSFHRVILGFSKRGK 45 >ref|XP_002313005.1| predicted protein [Populus trichocarpa] gi|222849413|gb|EEE86960.1| predicted protein [Populus trichocarpa] Length = 339 Score = 57.8 bits (138), Expect = 9e-07 Identities = 27/45 (60%), Positives = 35/45 (77%) Frame = +2 Query: 137 MELEIDKLLRAAWIAGIFPILLASLPITRIASFHRILSGFSNRGK 271 MEL + +LLRAAWIAG PIL+ASLP + + SFH ++ GF+ RGK Sbjct: 1 MELGLVELLRAAWIAGTLPILIASLPCSWLGSFHGLVLGFARRGK 45