BLASTX nr result
ID: Coptis25_contig00021489
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00021489 (357 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI24272.3| unnamed protein product [Vitis vinifera] 98 6e-19 ref|XP_002265253.1| PREDICTED: pentatricopeptide repeat-containi... 98 6e-19 ref|XP_004137278.1| PREDICTED: pentatricopeptide repeat-containi... 94 2e-17 ref|XP_003553033.1| PREDICTED: pentatricopeptide repeat-containi... 94 2e-17 ref|XP_002977643.1| hypothetical protein SELMODRAFT_107700 [Sela... 94 2e-17 >emb|CBI24272.3| unnamed protein product [Vitis vinifera] Length = 729 Score = 98.2 bits (243), Expect = 6e-19 Identities = 42/49 (85%), Positives = 45/49 (91%) Frame = +3 Query: 3 RIIKNLRVCGDCHEATKFISKLTDREIIMRDCYRFHHFVEGVCSCGDYW 149 RIIKNLRVCGDCH ATKFISK+ R+IIMRD YRFHHFV+GVCSCGDYW Sbjct: 681 RIIKNLRVCGDCHSATKFISKVEKRDIIMRDNYRFHHFVDGVCSCGDYW 729 >ref|XP_002265253.1| PREDICTED: pentatricopeptide repeat-containing protein At3g57430, chloroplastic-like [Vitis vinifera] Length = 972 Score = 98.2 bits (243), Expect = 6e-19 Identities = 42/49 (85%), Positives = 45/49 (91%) Frame = +3 Query: 3 RIIKNLRVCGDCHEATKFISKLTDREIIMRDCYRFHHFVEGVCSCGDYW 149 RIIKNLRVCGDCH ATKFISK+ R+IIMRD YRFHHFV+GVCSCGDYW Sbjct: 924 RIIKNLRVCGDCHSATKFISKVEKRDIIMRDNYRFHHFVDGVCSCGDYW 972 >ref|XP_004137278.1| PREDICTED: pentatricopeptide repeat-containing protein At4g33990-like [Cucumis sativus] gi|449476583|ref|XP_004154777.1| PREDICTED: pentatricopeptide repeat-containing protein At4g33990-like [Cucumis sativus] Length = 816 Score = 93.6 bits (231), Expect = 2e-17 Identities = 39/49 (79%), Positives = 44/49 (89%) Frame = +3 Query: 3 RIIKNLRVCGDCHEATKFISKLTDREIIMRDCYRFHHFVEGVCSCGDYW 149 +I KNLRVCGDCH ATKFISK+T+REII+RD RFHHF +GVCSCGDYW Sbjct: 768 QIFKNLRVCGDCHNATKFISKITEREIIVRDSNRFHHFKDGVCSCGDYW 816 >ref|XP_003553033.1| PREDICTED: pentatricopeptide repeat-containing protein At4g33990-like [Glycine max] Length = 824 Score = 93.6 bits (231), Expect = 2e-17 Identities = 38/49 (77%), Positives = 44/49 (89%) Frame = +3 Query: 3 RIIKNLRVCGDCHEATKFISKLTDREIIMRDCYRFHHFVEGVCSCGDYW 149 RI KNLRVCGDCH ATK+ISK+T+REII+RD RFHHF +G+CSCGDYW Sbjct: 776 RIFKNLRVCGDCHNATKYISKITEREIIVRDSNRFHHFKDGICSCGDYW 824 >ref|XP_002977643.1| hypothetical protein SELMODRAFT_107700 [Selaginella moellendorffii] gi|300154346|gb|EFJ20981.1| hypothetical protein SELMODRAFT_107700 [Selaginella moellendorffii] Length = 879 Score = 93.6 bits (231), Expect = 2e-17 Identities = 39/49 (79%), Positives = 43/49 (87%) Frame = +3 Query: 3 RIIKNLRVCGDCHEATKFISKLTDREIIMRDCYRFHHFVEGVCSCGDYW 149 RIIKNLRVCGDCH ATKFISK+T REI++RD +RFHHF G CSCGDYW Sbjct: 831 RIIKNLRVCGDCHTATKFISKITGREIVVRDSHRFHHFDNGTCSCGDYW 879