BLASTX nr result
ID: Coptis25_contig00021441
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00021441 (479 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFW87128.1| hypothetical protein ZEAMMB73_335999 [Zea mays] 63 2e-08 gb|AFW85303.1| hypothetical protein ZEAMMB73_833402 [Zea mays] 63 2e-08 gb|ABE98701.1| hypothetical protein (mitochondrion) [Zea mays su... 63 2e-08 gb|ABE98744.1| hypothetical protein (mitochondrion) [Zea mays su... 63 2e-08 ref|XP_002535310.1| conserved hypothetical protein [Ricinus comm... 60 2e-07 >gb|AFW87128.1| hypothetical protein ZEAMMB73_335999 [Zea mays] Length = 387 Score = 63.2 bits (152), Expect = 2e-08 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = +1 Query: 385 MARKGNPISVRLDLNRSSDPSRFSEGDRESN 477 MARKGNPISVRLDLNRSSDPSRFSEGDRES+ Sbjct: 1 MARKGNPISVRLDLNRSSDPSRFSEGDRESH 31 >gb|AFW85303.1| hypothetical protein ZEAMMB73_833402 [Zea mays] Length = 607 Score = 63.2 bits (152), Expect = 2e-08 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = +1 Query: 385 MARKGNPISVRLDLNRSSDPSRFSEGDRESN 477 MARKGNPISVRLDLNRSSDPSRFSEGDRES+ Sbjct: 1 MARKGNPISVRLDLNRSSDPSRFSEGDRESH 31 >gb|ABE98701.1| hypothetical protein (mitochondrion) [Zea mays subsp. mays] gi|102579661|gb|ABF70941.1| hypothetical protein (mitochondrion) [Zea mays subsp. mays] Length = 163 Score = 63.2 bits (152), Expect = 2e-08 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = +1 Query: 385 MARKGNPISVRLDLNRSSDPSRFSEGDRESN 477 MARKGNPISVRLDLNRSSDPSRFSEGDRES+ Sbjct: 1 MARKGNPISVRLDLNRSSDPSRFSEGDRESH 31 >gb|ABE98744.1| hypothetical protein (mitochondrion) [Zea mays subsp. mays] gi|93116158|gb|ABE98789.1| hypothetical protein [Zea mays subsp. mays] gi|413954480|gb|AFW87129.1| putative uncharacterized protein orf127 [Zea mays] Length = 159 Score = 63.2 bits (152), Expect = 2e-08 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = +1 Query: 385 MARKGNPISVRLDLNRSSDPSRFSEGDRESN 477 MARKGNPISVRLDLNRSSDPSRFSEGDRES+ Sbjct: 1 MARKGNPISVRLDLNRSSDPSRFSEGDRESH 31 >ref|XP_002535310.1| conserved hypothetical protein [Ricinus communis] gi|255590896|ref|XP_002535392.1| conserved hypothetical protein [Ricinus communis] gi|223523262|gb|EEF26991.1| conserved hypothetical protein [Ricinus communis] gi|223523475|gb|EEF27071.1| conserved hypothetical protein [Ricinus communis] Length = 94 Score = 60.1 bits (144), Expect = 2e-07 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = +1 Query: 385 MARKGNPISVRLDLNRSSDPSRFSEGDRESN 477 MARKGNPISVRLDLNRSSD SRFSEGDRES+ Sbjct: 1 MARKGNPISVRLDLNRSSDSSRFSEGDRESH 31